CymitQuimica logo
Peptidi

Peptidi

I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.

Sottocategorie di "Peptidi"

Trovati 30315 prodotti di "Peptidi"

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • Cyc-Biot-YCWSQYLCY-NH2


    Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45825

    ne
    Prezzo su richiesta
  • Lys-Asp-Cys


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C13H24N4O6S1
    Peso molecolare:364.42 g/mol

    Ref: 3D-PP50651

    ne
    Prezzo su richiesta
  • H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2


    <p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46273

    ne
    Prezzo su richiesta
  • HXB2 gag NO-46


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,624.8 g/mol

    Ref: 3D-PP50226

    ne
    Prezzo su richiesta
  • HXB2 gag NO-26


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,788 g/mol

    Ref: 3D-PP50576

    ne
    Prezzo su richiesta
  • H-SQIFSTASDNQPTVTIK^-OH


    <p>Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46250

    ne
    Prezzo su richiesta
  • H-FVNEEAL^R-OH


    <p>Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48800

    ne
    Prezzo su richiesta
  • H-VVSVLTVLHQDWL^NGK^-OH


    Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49827

    ne
    Prezzo su richiesta
  • H-SLFRAVITK^-OH


    <p>Peptide H-SLFRAVITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42137

    ne
    Prezzo su richiesta
  • H-MDYKDHDGDYKDHDIDYKDDDDK-NH2


    <p>Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44917

    ne
    Prezzo su richiesta
  • H-NVTGFFQSFK^-OH


    <p>Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45861

    ne
    Prezzo su richiesta
  • H-DTYIHWVR^-OH


    <p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41547

    ne
    Prezzo su richiesta
  • Mage-1 Antigen (161-169), human

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C41H57N11O17
    Peso molecolare:975.97 g/mol

    Ref: 3D-PP50148

    ne
    Prezzo su richiesta
  • MYH9 741-749 (HLA-A*02:01)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50196

    ne
    Prezzo su richiesta
  • H-TVAAPSVFIFPPSDEQLK^-OH


    <p>Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43148

    ne
    Prezzo su richiesta
  • H-LASGVPSR^-OH


    <p>Peptide H-LASGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41071

    ne
    Prezzo su richiesta
  • H-VVSVLTV^LHQDWLNGK^-OH


    <p>Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48051

    ne
    Prezzo su richiesta
  • CMVpp65 - 21 (YFTGSEVENVSVNVH)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,680.8 g/mol

    Ref: 3D-PP51029

    ne
    Prezzo su richiesta
  • Histone H3 (73 - 83)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C58H94N16O20
    Peso molecolare:1,335.6 g/mol

    Ref: 3D-PP50794

    ne
    Prezzo su richiesta
  • Biot-GRSRSRSRSRSR-NH2


    Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46260

    ne
    Prezzo su richiesta
  • HIV - 1 MN ENV - 169


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:2,058.5 g/mol

    Ref: 3D-PP51026

    ne
    Prezzo su richiesta
  • HXB2 gag NO-16


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,599.8 g/mol

    Ref: 3D-PP50316

    ne
    Prezzo su richiesta
  • H-SYSMEHFR^-OH


    Peptide H-SYSMEHFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41899

    ne
    Prezzo su richiesta
  • Fluor-NLVPMVATV-OH


    Peptide Fluor-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47001

    ne
    Prezzo su richiesta
  • H-GAYPLSIEPIGVR^-OH


    <p>Peptide H-GAYPLSIEPIGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47038

    ne
    Prezzo su richiesta
  • H-VDLLNQEIEFLK^-OH


    Peptide H-VDLLNQEIEFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42557

    ne
    Prezzo su richiesta
  • H-SGYLLPDTK^-OH


    <p>Peptide H-SGYLLPDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45771

    ne
    Prezzo su richiesta
  • H-AVFVDLEPTVIDEVR^-OH


    Peptide H-AVFVDLEPTVIDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42639

    ne
    Prezzo su richiesta
  • H-SVVAVIGLPNDPSVR^-OH


    <p>Peptide H-SVVAVIGLPNDPSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41351

    ne
    Prezzo su richiesta
  • LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH


    Peptide LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48399

    ne
    Prezzo su richiesta
  • Val-Ile-Leu


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formula:C17H33N3O4
    Peso molecolare:343.46 g/mol

    Ref: 3D-PP50669

    ne
    Prezzo su richiesta
  • H-GSFFLYSK^LTVD-OH


    Peptide H-GSFFLYSK^LTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42045

    ne
    Prezzo su richiesta
  • H-MPSKSASLRHTEAC-NH2


    <p>Peptide H-MPSKSASLRHTEAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43301

    ne
    Prezzo su richiesta
  • H-SGGGDLTLGLEPSEEEAPR^-OH


    <p>Peptide H-SGGGDLTLGLEPSEEEAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41013

    ne
    Prezzo su richiesta
  • Ac-CHHHHHH-OH PAB-402-60F


    <p>Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44967

    ne
    Prezzo su richiesta
  • H-GTVNLTWSR^-OH


    Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41371

    ne
    Prezzo su richiesta
  • H-LVVVGAGCVGK^-OH


    <p>Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42233

    ne
    Prezzo su richiesta
  • H-VVVGARGVGK^-OH


    <p>Peptide H-VVVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44550

    ne
    Prezzo su richiesta
  • Ac-QKRAA-NH2


    <p>Peptide Ac-QKRAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48330

    ne
    Prezzo su richiesta
  • LCBiot-HMRSAMSGLHLVKRR-OH


    <p>Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44932

    ne
    Prezzo su richiesta
  • gp100 (209-217)

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C47H74N10O14S
    Peso molecolare:1,035.2 g/mol

    Ref: 3D-PP50434

    ne
    Prezzo su richiesta
  • Asp-Asn-Glu-Asn-Val-Val-Asn-Glu-Tyr-Ser-Ser-Glu-Le


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C73H113N19O32
    Peso molecolare:1,768.79 g/mol

    Ref: 3D-PP50457

    ne
    Prezzo su richiesta
  • SIVmac239 - 89


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,441.7 g/mol

    Ref: 3D-PP50167

    ne
    Prezzo su richiesta
  • Lauric Acid-NPSSLFRYLPSD-OH


    <p>Peptide Lauric Acid-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45801

    ne
    Prezzo su richiesta
  • H-GLPSSIEK^-OH


    Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41057

    ne
    Prezzo su richiesta
  • H-DYVSQFEGSALGK^^^-OH


    Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47304

    ne
    Prezzo su richiesta
  • H-YGGFL^RRI-OH


    <p>Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46204

    ne
    Prezzo su richiesta
  • H-EP^QVYTLPPSR^-OH


    <p>Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44016

    ne
    Prezzo su richiesta
  • Human PTH (7-34) protein, Unconjugated


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:3.38 g/mol

    Ref: 3D-PP50138

    ne
    Prezzo su richiesta
  • Phytochelatin 2 (PC2)

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C18H29N5O10S2
    Peso molecolare:539.58 g/mol

    Ref: 3D-PP49970

    ne
    Prezzo su richiesta
  • H-L^TVL^-OH


    <p>Peptide H-L^TVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49422

    ne
    Prezzo su richiesta
  • H-CRQIKIWFQNRRMKWKK-NH2


    <p>Peptide H-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43294

    ne
    Prezzo su richiesta
  • H-TFEERN-NH2


    Peptide H-TFEERN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43941

    ne
    Prezzo su richiesta
  • NR-Box 2 Peptide


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,574.9 g/mol

    Ref: 3D-PP50818

    ne
    Prezzo su richiesta
  • Ac-CDYEFEKHINLDQ-NH2


    Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43236

    ne
    Prezzo su richiesta
  • H-QL^DAYPSGAW-OH


    Peptide H-QL^DAYPSGAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42397

    ne
    Prezzo su richiesta
  • Ac-KALETLRRVGDGVQRNHETAF-NH2


    <p>Peptide Ac-KALETLRRVGDGVQRNHETAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43639

    ne
    Prezzo su richiesta
  • H-ALAEHGIVFGEPK^-OH


    <p>Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42695

    ne
    Prezzo su richiesta
  • Ac-AVAGKAGAR-OH


    Peptide Ac-AVAGKAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45080

    ne
    Prezzo su richiesta
  • H-VVV-GGFL-OH


    Peptide H-VVV-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42962

    ne
    Prezzo su richiesta
  • H-Arg-Arg-Arg-Ala-Asp-Asp-Ser-Asp-Asp-Asp-Asp-Asp-OH

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C52H83N21O28
    Peso molecolare:1,450.36 g/mol

    Ref: 3D-PP50813

    ne
    Prezzo su richiesta
  • H-GDQGPVGR^-OH


    <p>Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41425

    ne
    Prezzo su richiesta
  • ttpa-SGSG-OH


    <p>Peptide ttpa-SGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49521

    ne
    Prezzo su richiesta
  • H-AQEEAEAEER^-OH


    <p>Peptide H-AQEEAEAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41909

    ne
    Prezzo su richiesta
  • LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH


    <p>Peptide LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49072

    ne
    Prezzo su richiesta
  • SIVmac239 envelope - 84


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:2,140.4 g/mol

    Ref: 3D-PP51052

    ne
    Prezzo su richiesta
  • Dynorphin A (1-8)

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C46H72N14O10
    Peso molecolare:981.17 g/mol

    Ref: 3D-PP50355

    ne
    Prezzo su richiesta
  • H-GQVFDVGPR^-OH


    <p>Peptide H-GQVFDVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47384

    ne
    Prezzo su richiesta
  • H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2


    Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49525

    ne
    Prezzo su richiesta
  • H-GTGNLELVAVR^-OH


    <p>Peptide H-GTGNLELVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42541

    ne
    Prezzo su richiesta
  • H-FEGDTLVNR^-OH


    <p>Peptide H-FEGDTLVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47711

    ne
    Prezzo su richiesta
  • H-SASL^HLPK-OH


    <p>Peptide H-SASL^HLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49111

    ne
    Prezzo su richiesta
  • H-VLQSALAAIR^ -OH


    <p>Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40267

    ne
    Prezzo su richiesta
  • H-P^GLYYF-OH


    <p>Peptide H-P^GLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41675

    ne
    Prezzo su richiesta
  • SIVmac239 - 27


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,699 g/mol

    Ref: 3D-PP50411

    ne
    Prezzo su richiesta
  • H-GADGVGK^SA-OH


    Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48947

    ne
    Prezzo su richiesta
  • Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C77H119N25O14
    Peso molecolare:1,618.95 g/mol

    Ref: 3D-PP50892

    ne
    Prezzo su richiesta
  • H-GALQNIIPASTGAAK^-OH


    <p>Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47285

    ne
    Prezzo su richiesta
  • GP120 - W61D - 54


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,704.1 g/mol

    Ref: 3D-PP50070

    ne
    Prezzo su richiesta
  • H-VGDTLNLNLR^-OH


    <p>Peptide H-VGDTLNLNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41759

    ne
    Prezzo su richiesta
  • H-AQDFVQWL^MNT-OH


    <p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42601

    ne
    Prezzo su richiesta
  • HXB2 gag NO-114


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,599.7 g/mol

    Ref: 3D-PP50337

    ne
    Prezzo su richiesta
  • Ac-YSPWTNF-OH


    <p>Peptide Ac-YSPWTNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46456

    ne
    Prezzo su richiesta
  • H-WLSLLVPFV^-OH


    Peptide H-WLSLLVPFV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41137

    ne
    Prezzo su richiesta
  • Peptide WE-14

    CAS:
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formula:C72H116N18O24S
    Peso molecolare:1,649.9 g/mol

    Ref: 3D-PP50088

    ne
    Prezzo su richiesta
  • Fluor-Y-OH


    <p>Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44632

    ne
    Prezzo su richiesta
  • H-AMHVAQPAVVLASSR^-OH


    <p>Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47365

    ne
    Prezzo su richiesta
  • H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH


    <p>Peptide H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42329

    ne
    Prezzo su richiesta
  • H-CDDRHDSGLDSMKDEE-NH2


    <p>Peptide H-CDDRHDSGLDSMKDEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43812

    ne
    Prezzo su richiesta
  • H-ALDNLAR^^-OH


    Peptide H-ALDNLAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43967

    ne
    Prezzo su richiesta
  • H-NTLYLQMNSLR^-OH


    <p>Peptide H-NTLYLQMNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40225

    ne
    Prezzo su richiesta
  • H-GADGVGKSAL^-OH


    Peptide H-GADGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48526

    ne
    Prezzo su richiesta
  • Ac-CLDSPLPLRQRLKLRFQST-OH


    <p>Peptide Ac-CLDSPLPLRQRLKLRFQST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45769

    ne
    Prezzo su richiesta
  • H-TPPSSGEPPK^-OH


    <p>Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47729

    ne
    Prezzo su richiesta
  • C34, gp41 HIV Fragment


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C184H280N50O64S1
    Peso molecolare:4,248.8 g/mol

    Ref: 3D-PP49974

    ne
    Prezzo su richiesta
  • Ac-RRRK-NH2


    <p>Peptide Ac-RRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44407

    ne
    Prezzo su richiesta
  • H-RPILTIITLEDSSGNLLGR^-OH


    Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42071

    ne
    Prezzo su richiesta
  • H-TVSLGAGAK^-OH


    <p>Peptide H-TVSLGAGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40989

    ne
    Prezzo su richiesta
  • H-VNVDEVGGEALGR^-OH


    <p>Peptide H-VNVDEVGGEALGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48897

    ne
    Prezzo su richiesta
  • H-VGVNGF^G^R-OH


    <p>Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48674

    ne
    Prezzo su richiesta
  • H-R^PPGFSPF-OH


    <p>Peptide H-R^PPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49367

    ne
    Prezzo su richiesta
  • H-FLLTKILTI^-OH


    <p>Peptide H-FLLTKILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41141

    ne
    Prezzo su richiesta
  • H-SYFQNCPRG-NH2


    Peptide H-SYFQNCPRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48370

    ne
    Prezzo su richiesta
  • H-LDVDQALNR^-OH


    <p>Peptide H-LDVDQALNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42663

    ne
    Prezzo su richiesta
  • Ac-KFKFKFKF-NH2


    <p>Peptide Ac-KFKFKFKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42737

    ne
    Prezzo su richiesta
  • Activity-Dependent Neurotrophic Factor, ADNF


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formula:C41H74N12O12
    Peso molecolare:927.12 g/mol

    Ref: 3D-PP50230

    ne
    Prezzo su richiesta
  • Pal-RWKFGGFKWR-OH


    <p>Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49511

    ne
    Prezzo su richiesta
  • H-NDGYLMFQQVPMVEIDGMK^-OH


    <p>Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42247

    ne
    Prezzo su richiesta
  • Ac-DSSVFAQ-OH


    <p>Peptide Ac-DSSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44602

    ne
    Prezzo su richiesta
  • H-GAGSSQHQER^-OH


    <p>Peptide H-GAGSSQHQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42543

    ne
    Prezzo su richiesta
  • H-VNTLTER^-OH


    <p>Peptide H-VNTLTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49087

    ne
    Prezzo su richiesta
  • H-DGQLTIK^-OH


    Peptide H-DGQLTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41849

    ne
    Prezzo su richiesta
  • [Cys9] - β - Amyloid (1 - 9)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,079.1 g/mol

    Ref: 3D-PP50229

    ne
    Prezzo su richiesta
  • Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2


    Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49010

    ne
    Prezzo su richiesta
  • CONSENSUS B Tat - 17


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,619.8 g/mol

    Ref: 3D-PP49997

    ne
    Prezzo su richiesta
  • H-YGLVTYATYPK^-OH


    Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42195

    ne
    Prezzo su richiesta
  • H-DTLYITR^-OH


    <p>Peptide H-DTLYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44035

    ne
    Prezzo su richiesta
  • LCBiot-LRELHLNNN-NH2


    Peptide LCBiot-LRELHLNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44118

    ne
    Prezzo su richiesta
  • H-KKSRGDYMTMQIG-NH2


    Peptide H-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47577

    ne
    Prezzo su richiesta
  • H-LLIVYPWTQR^-OH


    Peptide H-LLIVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40807

    ne
    Prezzo su richiesta
  • H-A^QCY-OH


    <p>Peptide H-A^QCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42345

    ne
    Prezzo su richiesta
  • Ac-CYIQNCPLG-NH2


    <p>Peptide Ac-CYIQNCPLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44137

    ne
    Prezzo su richiesta
  • Tum-P35B Peptide (NGPPHSNNFGY)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50801

    ne
    Prezzo su richiesta
  • H-DLLDTASALYR^-OH


    Peptide H-DLLDTASALYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43966

    ne
    Prezzo su richiesta
  • H-LGGGVSMANAANIPSK^-OH


    <p>Peptide H-LGGGVSMANAANIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43187

    ne
    Prezzo su richiesta
  • Ac-Rpr-NH2


    <p>Peptide Ac-Rpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46153

    ne
    Prezzo su richiesta
  • Biotin-LC-BimS BH3 (51-76) acid


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50584

    ne
    Prezzo su richiesta
  • H-MGKLSKIWDLPL^DE-OH


    <p>Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47861

    ne
    Prezzo su richiesta
  • Fluor-LMKNMDPLNDNV-NH2


    <p>Peptide Fluor-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45671

    ne
    Prezzo su richiesta
  • HXB2 gag NO-57


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,571.7 g/mol

    Ref: 3D-PP50412

    ne
    Prezzo su richiesta
  • Ac-YHPSAGDRFNRQRPC-NH2


    <p>Peptide Ac-YHPSAGDRFNRQRPC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46364

    ne
    Prezzo su richiesta
  • H-A^VLQ-OH


    <p>Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49794

    ne
    Prezzo su richiesta
  • H-VVVQTESGGR^-OH


    Peptide H-VVVQTESGGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44432

    ne
    Prezzo su richiesta
  • H-ENLQFSAAL^R-OH


    Peptide H-ENLQFSAAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49657

    ne
    Prezzo su richiesta
  • H-ICLDLQAPLYK^-OH


    Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42513

    ne
    Prezzo su richiesta
  • HPV 16 E2 69-77 (HLA-A*02:01)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50578

    ne
    Prezzo su richiesta
  • H-AQAVHPGYGFLSENK^-OH


    <p>Peptide H-AQAVHPGYGFLSENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43164

    ne
    Prezzo su richiesta
  • H-MHVAQPAVVLASSR^-OH


    <p>Peptide H-MHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40677

    ne
    Prezzo su richiesta
  • Angiotensin, Canine, Rat

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C41H62N12O11
    Peso molecolare:899 g/mol

    Ref: 3D-PP50386

    ne
    Prezzo su richiesta
  • Ac-CFLSPEELQSLVPLSD-NH2


    <p>Peptide Ac-CFLSPEELQSLVPLSD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49855

    ne
    Prezzo su richiesta
  • H-DGIIWVATEGALNTPK^-OH


    <p>Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49093

    ne
    Prezzo su richiesta
  • H-VGDGTVIL^^K^^-OH


    <p>Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40857

    ne
    Prezzo su richiesta
  • H-DTQSGSLLFIGR^-OH


    <p>Peptide H-DTQSGSLLFIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47997

    ne
    Prezzo su richiesta
  • LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH


    Peptide LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44548

    ne
    Prezzo su richiesta
  • H-VVSEDFLQDVSASTK^-OH


    <p>Peptide H-VVSEDFLQDVSASTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47602

    ne
    Prezzo su richiesta
  • H-GYSFVTTAER^-OH


    <p>Peptide H-GYSFVTTAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47736

    ne
    Prezzo su richiesta
  • Lunasine


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C204H321N65O78S3
    Peso molecolare:5,028.32 g/mol

    Ref: 3D-PP50422

    ne
    Prezzo su richiesta
  • H-SGFRK^ME-OH


    <p>Peptide H-SGFRK^ME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47185

    ne
    Prezzo su richiesta
  • H-YSDYFKPFSTGK^-OH


    <p>Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42255

    ne
    Prezzo su richiesta
  • H-VIFDANAPVAVR^-OH


    Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41855

    ne
    Prezzo su richiesta
  • HIV - 1 MN ENV - 197


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,976.3 g/mol

    Ref: 3D-PP49971

    ne
    Prezzo su richiesta
  • Lys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C41H75N11O11
    Peso molecolare:898.1 g/mol

    Ref: 3D-PP50784

    ne
    Prezzo su richiesta
  • LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH


    Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47245

    ne
    Prezzo su richiesta
  • HXB2 gag NO-29


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,554.6 g/mol

    Ref: 3D-PP50463

    ne
    Prezzo su richiesta
  • SIVmac239 - 12


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,618.8 g/mol

    Ref: 3D-PP50900

    ne
    Prezzo su richiesta
  • H-EGVVHGVATVAEK^-OH


    Peptide H-EGVVHGVATVAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41277

    ne
    Prezzo su richiesta
  • H-TSLAVLGK^-OH


    <p>Peptide H-TSLAVLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49325

    ne
    Prezzo su richiesta
  • PASD1 167-175 (HLA-A*02:01)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50560

    ne
    Prezzo su richiesta
  • H-RTARSLRRRFT-NH2


    Peptide H-RTARSLRRRFT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46667

    ne
    Prezzo su richiesta
  • H-LTYYTPEYETK^-OH


    <p>Peptide H-LTYYTPEYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42161

    ne
    Prezzo su richiesta
  • H-DRVYIHP-NH2


    Peptide H-DRVYIHP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42793

    ne
    Prezzo su richiesta
  • H-CRPKPQQFFGLM-NH2


    <p>Peptide H-CRPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45475

    ne
    Prezzo su richiesta
  • SIVmac239 - 55


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,710.9 g/mol

    Ref: 3D-PP50348

    ne
    Prezzo su richiesta
  • H-LLFGYPVYV^-OH


    <p>Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40517

    ne
    Prezzo su richiesta
  • H-MGKKQNRKTGNSKTC-NH2


    <p>Peptide H-MGKKQNRKTGNSKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45718

    ne
    Prezzo su richiesta
  • Val-Ile-Phe


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formula:C20H31N3O4
    Peso molecolare:377.48 g/mol

    Ref: 3D-PP50666

    ne
    Prezzo su richiesta
  • H-QGVAEAAGK^-OH


    Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47905

    ne
    Prezzo su richiesta
  • H-GLTSVINQK^-OH


    <p>Peptide H-GLTSVINQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40323

    ne
    Prezzo su richiesta
  • H-ILGFVFTL^T-OH


    Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42021

    ne
    Prezzo su richiesta
  • H-G^P-OH


    <p>Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42507

    ne
    Prezzo su richiesta
  • PB1(703 - 711), Influenza


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C45H75N15O13
    Peso molecolare:1,034.19 g/mol

    Ref: 3D-PP50038

    ne
    Prezzo su richiesta
  • H-EFSEV^EGR-OH


    <p>Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44573

    ne
    Prezzo su richiesta
  • H-TFTLLDPK^-OH


    <p>Peptide H-TFTLLDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40485

    ne
    Prezzo su richiesta
  • H-NSSVSGIFTFQK^-OH


    <p>Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41187

    ne
    Prezzo su richiesta
  • H-TAFQEALDAAGDK^-OH


    <p>Peptide H-TAFQEALDAAGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42611

    ne
    Prezzo su richiesta
  • H-IKGEHPGLSIGDVAK^-OH


    <p>Peptide H-IKGEHPGLSIGDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40115

    ne
    Prezzo su richiesta
  • H-GAL^^QNIIPASTGAAK-OH


    <p>Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46928

    ne
    Prezzo su richiesta
  • H-AEEDEILNR^-OH


    <p>Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41525

    ne
    Prezzo su richiesta
  • proFIX18


    <p>Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formula:C95H157N31O27
    Peso molecolare:2,165.5 g/mol

    Ref: 3D-PP49027

    ne
    Prezzo su richiesta
  • HXB2 gag NO-116/aa461 - 475


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,663.8 g/mol

    Ref: 3D-PP49954

    ne
    Prezzo su richiesta
  • H-YGIENVK^-OH


    <p>Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40227

    ne
    Prezzo su richiesta
  • H-SSIIHIER^-OH


    Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47783

    ne
    Prezzo su richiesta
  • H-APGLTQALNTK^-OH


    <p>Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45158

    ne
    Prezzo su richiesta
  • H-VQSLQDEVAFLR^-OH


    <p>Peptide H-VQSLQDEVAFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41169

    ne
    Prezzo su richiesta
  • H-HLQEYQDLLNVK^-OH


    <p>Peptide H-HLQEYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40605

    ne
    Prezzo su richiesta
  • H-ADHVSFNGYER^-OH


    <p>Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40673

    ne
    Prezzo su richiesta
  • H-FSVVYAK^-OH


    <p>Peptide H-FSVVYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40425

    ne
    Prezzo su richiesta
  • H-LFGPVDSEQLSR^-OH


    Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48321

    ne
    Prezzo su richiesta
  • Ac-LLVP-NH2


    <p>Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44612

    ne
    Prezzo su richiesta
  • pE-VHHQK-OH


    <p>Peptide pE-VHHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48258

    ne
    Prezzo su richiesta
  • H-TGTTVPESIHSFIGDGLVKPEALNK^-OH


    <p>Peptide H-TGTTVPESIHSFIGDGLVKPEALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47270

    ne
    Prezzo su richiesta
  • β Amyloid 25-39


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Peso molecolare:1,372.65 g/mol

    Ref: 3D-PP50185

    ne
    Prezzo su richiesta
  • H-MATDPENIIK^-OH


    <p>Peptide H-MATDPENIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41267

    ne
    Prezzo su richiesta
  • Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y


    <p>Peptide Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42923

    ne
    Prezzo su richiesta
  • H-VPGVG^-OH


    Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47716

    ne
    Prezzo su richiesta
  • Ac-AGCMPYVRIPTA-NH2


    <p>Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45083

    ne
    Prezzo su richiesta
  • H-WEAAHVAEQLR^-OH


    <p>Peptide H-WEAAHVAEQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41181

    ne
    Prezzo su richiesta
  • Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2


    Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47283

    ne
    Prezzo su richiesta
  • H-EIYKRWII^-OH


    Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48821

    ne
    Prezzo su richiesta
  • H-LEGPGEQETK^-OH


    Peptide H-LEGPGEQETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48219

    ne
    Prezzo su richiesta