
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30315 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C13H24N4O6S1Peso molecolare:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
<p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,624.8 g/molHXB2 gag NO-26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,788 g/molH-SQIFSTASDNQPTVTIK^-OH
<p>Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVNEEAL^R-OH
<p>Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSVLTVLHQDWL^NGK^-OH
Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLFRAVITK^-OH
<p>Peptide H-SLFRAVITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDYKDHDGDYKDHDIDYKDDDDK-NH2
<p>Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVTGFFQSFK^-OH
<p>Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTYIHWVR^-OH
<p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mage-1 Antigen (161-169), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H57N11O17Peso molecolare:975.97 g/molMYH9 741-749 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-TVAAPSVFIFPPSDEQLK^-OH
<p>Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LASGVPSR^-OH
<p>Peptide H-LASGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSVLTV^LHQDWLNGK^-OH
<p>Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 21 (YFTGSEVENVSVNVH)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,680.8 g/molHistone H3 (73 - 83)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C58H94N16O20Peso molecolare:1,335.6 g/molBiot-GRSRSRSRSRSR-NH2
Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 169
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,058.5 g/molHXB2 gag NO-16
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,599.8 g/molH-SYSMEHFR^-OH
Peptide H-SYSMEHFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-NLVPMVATV-OH
Peptide Fluor-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAYPLSIEPIGVR^-OH
<p>Peptide H-GAYPLSIEPIGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDLLNQEIEFLK^-OH
Peptide H-VDLLNQEIEFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGYLLPDTK^-OH
<p>Peptide H-SGYLLPDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVFVDLEPTVIDEVR^-OH
Peptide H-AVFVDLEPTVIDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVVAVIGLPNDPSVR^-OH
<p>Peptide H-SVVAVIGLPNDPSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH
Peptide LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Val-Ile-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C17H33N3O4Peso molecolare:343.46 g/molH-GSFFLYSK^LTVD-OH
Peptide H-GSFFLYSK^LTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MPSKSASLRHTEAC-NH2
<p>Peptide H-MPSKSASLRHTEAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGGGDLTLGLEPSEEEAPR^-OH
<p>Peptide H-SGGGDLTLGLEPSEEEAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CHHHHHH-OH PAB-402-60F
<p>Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVNLTWSR^-OH
Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGCVGK^-OH
<p>Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGARGVGK^-OH
<p>Peptide H-VVVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QKRAA-NH2
<p>Peptide Ac-QKRAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-HMRSAMSGLHLVKRR-OH
<p>Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>gp100 (209-217)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C47H74N10O14SPeso molecolare:1,035.2 g/molAsp-Asn-Glu-Asn-Val-Val-Asn-Glu-Tyr-Ser-Ser-Glu-Le
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C73H113N19O32Peso molecolare:1,768.79 g/molSIVmac239 - 89
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,441.7 g/molLauric Acid-NPSSLFRYLPSD-OH
<p>Peptide Lauric Acid-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLPSSIEK^-OH
Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYVSQFEGSALGK^^^-OH
Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRI-OH
<p>Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EP^QVYTLPPSR^-OH
<p>Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Human PTH (7-34) protein, Unconjugated
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:3.38 g/molPhytochelatin 2 (PC2)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C18H29N5O10S2Peso molecolare:539.58 g/molH-L^TVL^-OH
<p>Peptide H-L^TVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRQIKIWFQNRRMKWKK-NH2
<p>Peptide H-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFEERN-NH2
Peptide H-TFEERN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NR-Box 2 Peptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,574.9 g/molAc-CDYEFEKHINLDQ-NH2
Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QL^DAYPSGAW-OH
Peptide H-QL^DAYPSGAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KALETLRRVGDGVQRNHETAF-NH2
<p>Peptide Ac-KALETLRRVGDGVQRNHETAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALAEHGIVFGEPK^-OH
<p>Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AVAGKAGAR-OH
Peptide Ac-AVAGKAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVV-GGFL-OH
Peptide H-VVV-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-Arg-Arg-Ala-Asp-Asp-Ser-Asp-Asp-Asp-Asp-Asp-OH
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C52H83N21O28Peso molecolare:1,450.36 g/molH-GDQGPVGR^-OH
<p>Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ttpa-SGSG-OH
<p>Peptide ttpa-SGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQEEAEAEER^-OH
<p>Peptide H-AQEEAEAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH
<p>Peptide LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 envelope - 84
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:2,140.4 g/molDynorphin A (1-8)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C46H72N14O10Peso molecolare:981.17 g/molH-GQVFDVGPR^-OH
<p>Peptide H-GQVFDVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTGNLELVAVR^-OH
<p>Peptide H-GTGNLELVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEGDTLVNR^-OH
<p>Peptide H-FEGDTLVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SASL^HLPK-OH
<p>Peptide H-SASL^HLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQSALAAIR^ -OH
<p>Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-P^GLYYF-OH
<p>Peptide H-P^GLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 27
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,699 g/molH-GADGVGK^SA-OH
Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C77H119N25O14Peso molecolare:1,618.95 g/molH-GALQNIIPASTGAAK^-OH
<p>Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,704.1 g/molH-VGDTLNLNLR^-OH
<p>Peptide H-VGDTLNLNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQDFVQWL^MNT-OH
<p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-114
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,599.7 g/molAc-YSPWTNF-OH
<p>Peptide Ac-YSPWTNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WLSLLVPFV^-OH
Peptide H-WLSLLVPFV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide WE-14
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C72H116N18O24SPeso molecolare:1,649.9 g/molFluor-Y-OH
<p>Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMHVAQPAVVLASSR^-OH
<p>Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH
<p>Peptide H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDDRHDSGLDSMKDEE-NH2
<p>Peptide H-CDDRHDSGLDSMKDEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDNLAR^^-OH
Peptide H-ALDNLAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTLYLQMNSLR^-OH
<p>Peptide H-NTLYLQMNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GADGVGKSAL^-OH
Peptide H-GADGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CLDSPLPLRQRLKLRFQST-OH
<p>Peptide Ac-CLDSPLPLRQRLKLRFQST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPPSSGEPPK^-OH
<p>Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C34, gp41 HIV Fragment
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C184H280N50O64S1Peso molecolare:4,248.8 g/molAc-RRRK-NH2
<p>Peptide Ac-RRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPILTIITLEDSSGNLLGR^-OH
Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVSLGAGAK^-OH
<p>Peptide H-TVSLGAGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVDEVGGEALGR^-OH
<p>Peptide H-VNVDEVGGEALGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGVNGF^G^R-OH
<p>Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^PPGFSPF-OH
<p>Peptide H-R^PPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLTKILTI^-OH
<p>Peptide H-FLLTKILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYFQNCPRG-NH2
Peptide H-SYFQNCPRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDVDQALNR^-OH
<p>Peptide H-LDVDQALNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KFKFKFKF-NH2
<p>Peptide Ac-KFKFKFKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Activity-Dependent Neurotrophic Factor, ADNF
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C41H74N12O12Peso molecolare:927.12 g/molPal-RWKFGGFKWR-OH
<p>Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NDGYLMFQQVPMVEIDGMK^-OH
<p>Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DSSVFAQ-OH
<p>Peptide Ac-DSSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGSSQHQER^-OH
<p>Peptide H-GAGSSQHQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNTLTER^-OH
<p>Peptide H-VNTLTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGQLTIK^-OH
Peptide H-DGQLTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Cys9] - β - Amyloid (1 - 9)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,079.1 g/molAc-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2
Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,619.8 g/molH-YGLVTYATYPK^-OH
Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTLYITR^-OH
<p>Peptide H-DTLYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LRELHLNNN-NH2
Peptide LCBiot-LRELHLNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKSRGDYMTMQIG-NH2
Peptide H-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIVYPWTQR^-OH
Peptide H-LLIVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^QCY-OH
<p>Peptide H-A^QCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CYIQNCPLG-NH2
<p>Peptide Ac-CYIQNCPLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tum-P35B Peptide (NGPPHSNNFGY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DLLDTASALYR^-OH
Peptide H-DLLDTASALYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGGVSMANAANIPSK^-OH
<p>Peptide H-LGGGVSMANAANIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpr-NH2
<p>Peptide Ac-Rpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biotin-LC-BimS BH3 (51-76) acid
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-MGKLSKIWDLPL^DE-OH
<p>Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-LMKNMDPLNDNV-NH2
<p>Peptide Fluor-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-57
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,571.7 g/molAc-YHPSAGDRFNRQRPC-NH2
<p>Peptide Ac-YHPSAGDRFNRQRPC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-A^VLQ-OH
<p>Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVQTESGGR^-OH
Peptide H-VVVQTESGGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENLQFSAAL^R-OH
Peptide H-ENLQFSAAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ICLDLQAPLYK^-OH
Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HPV 16 E2 69-77 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-AQAVHPGYGFLSENK^-OH
<p>Peptide H-AQAVHPGYGFLSENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MHVAQPAVVLASSR^-OH
<p>Peptide H-MHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin, Canine, Rat
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H62N12O11Peso molecolare:899 g/molAc-CFLSPEELQSLVPLSD-NH2
<p>Peptide Ac-CFLSPEELQSLVPLSD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGIIWVATEGALNTPK^-OH
<p>Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDGTVIL^^K^^-OH
<p>Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTQSGSLLFIGR^-OH
<p>Peptide H-DTQSGSLLFIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
Peptide LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVSEDFLQDVSASTK^-OH
<p>Peptide H-VVSEDFLQDVSASTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYSFVTTAER^-OH
<p>Peptide H-GYSFVTTAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lunasine
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C204H321N65O78S3Peso molecolare:5,028.32 g/molH-SGFRK^ME-OH
<p>Peptide H-SGFRK^ME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSDYFKPFSTGK^-OH
<p>Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIFDANAPVAVR^-OH
Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 197
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,976.3 g/molLys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H75N11O11Peso molecolare:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-29
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,554.6 g/molSIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,618.8 g/molH-EGVVHGVATVAEK^-OH
Peptide H-EGVVHGVATVAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSLAVLGK^-OH
<p>Peptide H-TSLAVLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PASD1 167-175 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-RTARSLRRRFT-NH2
Peptide H-RTARSLRRRFT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTYYTPEYETK^-OH
<p>Peptide H-LTYYTPEYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHP-NH2
Peptide H-DRVYIHP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRPKPQQFFGLM-NH2
<p>Peptide H-CRPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,710.9 g/molH-LLFGYPVYV^-OH
<p>Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGKKQNRKTGNSKTC-NH2
<p>Peptide H-MGKKQNRKTGNSKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C20H31N3O4Peso molecolare:377.48 g/molH-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLTSVINQK^-OH
<p>Peptide H-GLTSVINQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^P-OH
<p>Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PB1(703 - 711), Influenza
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H75N15O13Peso molecolare:1,034.19 g/molH-EFSEV^EGR-OH
<p>Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFTLLDPK^-OH
<p>Peptide H-TFTLLDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSVSGIFTFQK^-OH
<p>Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAFQEALDAAGDK^-OH
<p>Peptide H-TAFQEALDAAGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IKGEHPGLSIGDVAK^-OH
<p>Peptide H-IKGEHPGLSIGDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAL^^QNIIPASTGAAK-OH
<p>Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEEDEILNR^-OH
<p>Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>proFIX18
<p>Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C95H157N31O27Peso molecolare:2,165.5 g/molHXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,663.8 g/molH-YGIENVK^-OH
<p>Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APGLTQALNTK^-OH
<p>Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQSLQDEVAFLR^-OH
<p>Peptide H-VQSLQDEVAFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLQEYQDLLNVK^-OH
<p>Peptide H-HLQEYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADHVSFNGYER^-OH
<p>Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSVVYAK^-OH
<p>Peptide H-FSVVYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFGPVDSEQLSR^-OH
Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LLVP-NH2
<p>Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-VHHQK-OH
<p>Peptide pE-VHHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGTTVPESIHSFIGDGLVKPEALNK^-OH
<p>Peptide H-TGTTVPESIHSFIGDGLVKPEALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β Amyloid 25-39
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,372.65 g/molH-MATDPENIIK^-OH
<p>Peptide H-MATDPENIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y
<p>Peptide Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AGCMPYVRIPTA-NH2
<p>Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WEAAHVAEQLR^-OH
<p>Peptide H-WEAAHVAEQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2
Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIYKRWII^-OH
Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEGPGEQETK^-OH
Peptide H-LEGPGEQETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
