
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30311 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rhod-VPMLKE-OH
<p>Peptide Rhod-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFormula:C192H295N61O60SPurezza:Min. 95%Peso molecolare:4,449.93 g/molAc-PKKKRKVEDPYC-OH
Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YIDIPELVANVK^-OH
<p>Peptide H-YIDIPELVANVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYTITGLQPGTDYK^-OH
<p>Peptide H-SYTITGLQPGTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTYHTNEAK^-OH
<p>Peptide H-GTYHTNEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STELLIR^-OH
<p>Peptide H-STELLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-64
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,795.2 g/molAc-IWIAQELRRIGDEFNAYYARR-NH2
Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEATFGVDESNAK^-OH
<p>Peptide H-VEATFGVDESNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAAAGVSGLNAGNAASIPSK^-OH
<p>Peptide H-NAAAGVSGLNAGNAASIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LQPELDSFKEELDKY-OH
<p>Peptide LCBiot-LQPELDSFKEELDKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Vasostatin I / prepro-Chromogranin A (19-94) (Human) - I-125 Labeled
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:8,553.9 g/molDRB1*01:01 gag DYVDRFYKTLRAE
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>[pGlu3]-Amyloid-β Protein (3-42) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:4,309.9 g/molThr-Val-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C18H27N3O5Peso molecolare:365.42 g/molH-IADYNYK^-OH
<p>Peptide H-IADYNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 10 (HETRLLQTGIHVRVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,746 g/molH-FNWY^VDGVEVHNAK-OH
<p>Peptide H-FNWY^VDGVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VL^IGLDLLYGELQDSDDF-OH
Peptide H-VL^IGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-KPLLIIAEDVEGEY-OH
<p>Peptide Biot-KPLLIIAEDVEGEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-LALLAK-NH2
Peptide Aoa-LALLAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SIINFEKL-OH
<p>Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-HNSSLSPLATPA-OH
Peptide Fluor-HNSSLSPLATPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HAIYPRH-OH
<p>Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo[Arg-Gly-Asp-D-Phe-Lys(dPEG®4)]
<p>Cyclo[Arg-Gly-Asp-D-Phe-Lys(dPEG®4)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Formula:C38H62N10O12Purezza:Min. 95%Peso molecolare:850.98 g/molSDADLinker-GGEPEA-OH
Peptide SDADLinker-GGEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-11-aminoundecanoic acid
CAS:<p>Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.</p>Formula:C26H33NO4Purezza:Min. 98.0 Area-%Peso molecolare:423.56 g/molH-[Lys-Leu-Ala-Lys-Leu-Ala-Lys]2-Gly-Phe-Leu-Gly-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH
<p>This peptide is a cell-penetrating peptide (CPP) that is derived from the amino acid sequence of the human protein, integrin alpha 4. It binds to the α4β1 integrin receptor on the surface of cancer cells and causes apoptosis. This CPP can also be used as a target for various other biochemicals, such as chemotherapeutic agents, radionuclides, and antibodies, which can then bind to this target and induce apoptosis in cancer cells.</p>Formula:C142H234N36O35S3Purezza:Min. 95%Peso molecolare:3,101.86 g/molAc-ARTKQTARKSTGGKA-NH2
<p>Peptide Ac-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[pTyr5] EGFR (988-993)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C31H45N6O17PPeso molecolare:804.69 g/molTachyplesin1-amide
<p>Peptide Tachyplesin1-amide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C99H151N35O19S4Peso molecolare:2,263.76 g/molLCBiot-AIIGLMVGGVVIA-OH
<p>Peptide LCBiot-AIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Arg-Ala-Asp-Ser-Lys-OH
H-Arg-Ala-Asp-Ser-Lys-OH is a peptide that is used in biochemistry research as a substrate for protease enzymes. It has the sequence H-Arg-Ala-Asp-Ser-Lys and is labeled with a fluorescent dye.Formula:C22H41N9O9Purezza:Min. 95%Peso molecolare:575.63 g/molH-YISPDQLADLYK^-OH
<p>Peptide H-YISPDQLADLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPPGFSPF^-OH
<p>Peptide H-RPPGFSPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDSLAYGLR^-OH
<p>Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLSLTYDQK^-OH
Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLQNSGKFRAESRGDC-NH2
<p>Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVYDGREHTV^-OH
<p>Peptide H-GVYDGREHTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPIYFTGLASEPGAR^-OH
Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AATVGSLAGQPLQER^-OH
Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISAPNVDFNLEGPK^-OH
<p>Peptide H-ISAPNVDFNLEGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-D-His(Trt)-OH
CAS:<p>Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum.<br>Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and re</p>Formula:C40H33N3O4Purezza:Min. 95%Peso molecolare:619.73 g/molH-IQASFR^-OH
<p>Peptide H-IQASFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-TETSQVAPA-OH
<p>Peptide Ac-TETSQVAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HVGDLGNVTADK^-OH
Peptide H-HVGDLGNVTADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KALETLRRVGDGVQRNHETAF-NH2
<p>Peptide Ac-KALETLRRVGDGVQRNHETAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGVDDAFYTLVR^-OH
<p>Peptide H-QGVDDAFYTLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-73
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,961.2 g/molTertiapin Q
CAS:<p>Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.</p>Formula:C106H175N35O24S4Purezza:Min. 95%Peso molecolare:2,452.05 g/molMART-1 26-35 (HLA-B*35:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-CESLEQEAAN-OH
<p>Peptide Ac-CESLEQEAAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV-gp120-Fragment (318-327)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C48H80N16O12Peso molecolare:1,073.27 g/molOxytocin
CAS:<p>Oxytocin is an endogenous hormone.</p>Formula:C43H65N11O13S2Peso molecolare:1,008.19 g/molH-GLFIIDDK^-OH
<p>Peptide H-GLFIIDDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^KALLALALHHLAHLALHLALALKK^A-OH
<p>Peptide H-K^KALLALALHHLAHLALHLALALKK^A-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EB1
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C150H236N46O26Peso molecolare:3,099.77 g/molH-IR^QYLAQWLE-OH
Peptide H-IR^QYLAQWLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Lys(Me2)4]-Histone H3 (1-21), H3K4(Me2)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C96H176N36O28Peso molecolare:2,282.6 g/molGonadoliberin-2 (Human, Chicken)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,236.33 g/mol5FAM-NWAPGEPNNR-OH
<p>Peptide 5FAM-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HG^EG^TF^TSDLSKQMEEEAVR^LFIEWLKNGGPSSGAPP^PS-NH2
<p>Peptide H-HG^EG^TF^TSDLSKQMEEEAVR^LFIEWLKNGGPSSGAPP^PS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LGRI-NH2
Peptide Ac-LGRI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HCMV pp65 363-373 (HLA-A*01:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolZiptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C65H109N19O19Peso molecolare:1,460.69 g/molOct4
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FFVAPFPEVF^GK-OH
<p>Peptide H-FFVAPFPEVF^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYSTDYYR^-OH
<p>Peptide H-DIYSTDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGEIQPVSVK^-OH
<p>Peptide H-GGEIQPVSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIDNKPSIDSYSK^-OH
<p>Peptide H-IIDNKPSIDSYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myelin PLP (180-199)
<p>Myelin PLP (180-199) is a peptide that has been shown to be immunogenic and biochemically active. It belongs to the group of peptides and biochemicals, which are organic compounds of high molecular weight. Myelin PLP (180-199) is an immunogenic compound that can be used as a vaccine adjuvant. It also has been shown to have anti-inflammatory activities, which may be due to its ability to inhibit prostaglandin synthesis.</p>Formula:C92H144N23O30SPurezza:Min. 95%Peso molecolare:2,084.37 g/molH-YEASILTHDSSIR^-OH
<p>Peptide H-YEASILTHDSSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNQLLR^-OH
<p>Peptide H-YNQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITPTDSR^-OH
<p>Peptide H-ITPTDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2
CAS:Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2 is a peptide that has been shown to inhibit the formation of amyloid fibrils in Alzheimer's Disease. Ac-Lys-N-Me-Leu-Val-N-Me-Phe (KLVFF) is a biologically active peptide that is membrane permeable, allowing it to cross the blood brain barrier and enter the central nervous system. It inhibits the fibrillogenesis of amyloid beta protein, preventing it from aggregating into plaques.Formula:C39H59N7O6Purezza:Min. 95%Peso molecolare:721.95 g/molSIVmac239 - 96
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,753.1 g/molH-SVTV-NH2
Peptide H-SVTV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ACTH (1-24), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C136H210N40O31SPeso molecolare:2,933.5 g/molH-NSILTETLHR^-OH
Peptide H-NSILTETLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Lys(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Lys(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that can be used for the synthesis of peptides. It is an amine resin that contains two reactive groups, one thiol and one amine. H-Lys(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is also a building block for alcohols and thiols.</p>Purezza:Min. 95%H-LADFADALEHPLR^-OH
Peptide H-LADFADALEHPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-2Kb Mouse Survivin MFFCFKEL
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Biot-PTTDSTTPAPTTK-NH2
<p>Peptide Biot-PTTDSTTPAPTTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLGDQDLK^-OH
<p>Peptide H-VVLGDQDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 68 (RNGFTVLCPKNMIIK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,734.2 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH is a monoclonal antibody (mAb) that binds to the cell surface receptor, TGFβRI. It has been shown to exhibit biological activities including inhibition of tumor growth and induction of apoptosis in cancer cells. This mAb can be used as a tumor treatment and can also inhibit the proliferation of cells in tissue culture. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys has been shown to inhibit the production of collagen, which may be due to its ability to block integrin activation by binding to the cell surface receptor, αVβ3. HGRGSSPC has also been found to have antiangiogenic properties, which may be due to its ability to bind with high affinity and specificity to αVβ3 on endothelial cells.</p>Formula:C23H42N10O11SPurezza:Min. 95%Peso molecolare:690.74 g/molH-SGFSSVSVSR^-OH
Peptide H-SGFSSVSVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQEEDTGEYGCV-NH2
<p>Peptide H-LQEEDTGEYGCV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H82N12O12S1Peso molecolare:1,015.27 g/molAc-CEKEEDERVQGGDREPLLQEE-OH
Peptide Ac-CEKEEDERVQGGDREPLLQEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSEADSSNADWVTK^-OH
<p>Peptide H-VSEADSSNADWVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phosphorylated Protein Kinase C Substrate 2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C34H69N16O11PPeso molecolare:909.02 g/molH-ADEGISFR^-OH
Peptide H-ADEGISFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDNDENEHQLSLR^-OH
<p>Peptide H-VDNDENEHQLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTGEVLDILTR^-OH
Peptide H-VTGEVLDILTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA-A*02:01 Human RNA-dependent helicase YLLPAIVHI
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-SPAQILQWQVLSNTVPAK^-OH
Peptide H-SPAQILQWQVLSNTVPAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin Basic Protein (1-20)
<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C92H156N30O32SPurezza:Min. 95%Peso molecolare:2,226.51 g/mol5Fam-SVQGMSQDPVAVAASNNPEL-OH
Peptide 5Fam-SVQGMSQDPVAVAASNNPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPTLLTEAPL^NPK-OH
Peptide H-VAPEEHPTLLTEAPL^NPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVSGLNAGNAASIPSK^-OH
Peptide H-GVSGLNAGNAASIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WSASALAKI-OH
<p>Peptide Ac-WSASALAKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Urocortin III (human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C185H307N53O50S2Peso molecolare:4,137.93 g/molLCBiot-RVTHHAFLGAHRTVG-OH
Peptide LCBiot-RVTHHAFLGAHRTVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^T^SGSTST^SR^-OH
Peptide H-V^T^SGSTST^SR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LVLRLRGG-CHO
<p>Peptide Ac-LVLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVLGQL^GITK-OH
<p>Peptide H-SVLGQL^GITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,844 g/molH-TYLPAV^DEK-OH
Peptide H-TYLPAV^DEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Gly-Wang Resin (100-200 mesh) 1% DVB
<p>Fmoc-Gly-Wang Resin is a high purity resin that is used as an inhibitor in peptide synthesis. It is supplied at a 1% DVB content. This resin has been used in the synthesis of many biologically active peptides, including vasopressin and oxytocin. Fmoc-Gly-Wang Resin is also used for receptor binding studies, antibody production and ion channel research.</p>Purezza:Min. 95%TAMRA-QKRPSQRSKYL-OH
<p>Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFVFG^T^TPEDILR-OH
<p>Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFDFVPPVVR^-OH
<p>Peptide H-DFDFVPPVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALYYLQIHPQELR^-OH
Peptide H-ALYYLQIHPQELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-THLAPYSDELR^-OH
<p>Peptide H-THLAPYSDELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLIPNATQPESK^-OH
<p>Peptide H-YLIPNATQPESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSEIVAGLEK^-OH
<p>Peptide H-GSEIVAGLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 9
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,810.1 g/molH-GADGVGK^SAL-OH
Peptide H-GADGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASMTNMEL^M-OH
<p>Peptide H-ASMTNMEL^M-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QMESQPLPGER^-OH
Peptide H-QMESQPLPGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WRWYCR-NH2
<p>Peptide H-WRWYCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biotin-BimS BH3 (51-76) amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-GAILSSTNVGSNTY-NH2
<p>Peptide H-GAILSSTNVGSNTY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALVDQVIGSR^-OH
<p>Peptide H-ALVDQVIGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIDGYFK^-OH
<p>Peptide H-NIDGYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLQNFLK^-OH
<p>Peptide H-DLQNFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGFPWSEIR^-OH
<p>Peptide H-IGFPWSEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNMLNNNYK^-OH
<p>Peptide H-LNMLNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVMLPVADQDK^-OH
<p>Peptide H-YVMLPVADQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SADTNKRKRDEGIQESPVC-NH2
Peptide Ac-SADTNKRKRDEGIQESPVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TLQP-62, Rat
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:7,401.13 g/molH-VLDALDSIK^-OH
Peptide H-VLDALDSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AHYDLR^-OH
<p>Peptide H-AHYDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTAIGGAYNVGR^-OH
Peptide H-GTAIGGAYNVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-M^KVLQEPTCVSDY-OH
<p>Peptide H-M^KVLQEPTCVSDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGAGDVAFV^K-OH
Peptide H-DGAGDVAFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^LVFFAEDVGSN-OH
<p>Peptide H-K^LVFFAEDVGSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nma-Phe-His-Lys(Dnp)
<p>Nma-Phe-His-Lys(Dnp) is a peptide that binds to the nicotinic acetylcholine receptor (nAChR) and activates it. This peptide has been shown to be effective in activating nAChRs at concentrations of 1 nM or less. It also has high purity, and can be used as a research tool for studying ion channels and ligands.</p>Purezza:Min. 95%H-GAGAGAGY^-OH
<p>Peptide H-GAGAGAGY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GSTSGSGKPGSGEGSTKG-NH2
<p>Peptide LCBiot-GSTSGSGKPGSGEGSTKG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFLVWVNEEDHLR^-OH
<p>Peptide H-SFLVWVNEEDHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDLHAFENLEIIR^-OH
Peptide H-TDLHAFENLEIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIGELYLP^K-OH
<p>Peptide H-EIGELYLP^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AISEELDHAL^NDMTSI-OH
<p>Peptide H-AISEELDHAL^NDMTSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQSALAAIR^ -OH
<p>Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 91
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,562.7 g/molAc-FYWHCLDE-OH
Peptide Ac-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tau Conotoxin CnVA
CAS:<p>Tau Conotoxin CnVA is a peptide toxin derived from the venom of the cone snail. It has been shown to be a receptor agonist and to cause pain. Tau Conotoxin CnVA is a disulfide-rich peptide that has been shown to have neurotoxic effects in mammalian cells.</p>Formula:C72H116N24O17S4Purezza:Min. 95%Peso molecolare:1,718.13 g/molCMVpp65 - 127 (GQNLKYQEFFWDAND)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,875 g/molPresenilin-1 (S182 Protein) (431-467) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:4,299.09 g/mol5-FAM-LRRASLG-OH
<p>Peptide 5-FAM-LRRASLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-KTWGQYWQV-OH
<p>Peptide Biot-KTWGQYWQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BTN2A1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTN2A1 antibody, catalog no. 70R-7238</p>Purezza:Min. 95%CRF (human, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C208H344N60O63S2Peso molecolare:4,758 g/molH-RV^YIHP-OH
Peptide H-RV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESLITLIEK^-OH
<p>Peptide H-ESLITLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-HHHHHHHHHHHHHHHHHHHH-NH2
<p>Peptide Aoa-HHHHHHHHHHHHHHHHHHHH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKTVKFK-MAP4
<p>Peptide H-AKTVKFK-MAP4 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAIIK^-OH
Peptide H-NAIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BBC3-related peptide amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-SYEL-OH
<p>Peptide Ac-SYEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSSYWYAFNNKT-NH2
Peptide H-HSSYWYAFNNKT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Arg-Gly-Lys(Ac)-MCA
CAS:<p>Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that is used as a histone deacetylase substrate. It is an enzyme substrate in the histone deacetylase reaction and it has been shown to inhibit the growth of many bacterial strains. Ac-Arg-Gly-Lys(Ac)-MCA has been shown to inhibit the growth of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa.</p>Formula:C28H40N8O7Purezza:Min. 95%Peso molecolare:600.68 g/molLCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2
Peptide LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASGQAFELILSPR^-OH
<p>Peptide H-ASGQAFELILSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Exendin (9-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C149H234N40O47SPeso molecolare:3,369.79 g/molH-HGEVCPAGW-NH2
<p>Peptide H-HGEVCPAGW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YIQDIVASTLK^-OH
Peptide H-YIQDIVASTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVINDPVYK^-OH
<p>Peptide H-SVINDPVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Tamra-RRRRRRRRR-NH2
<p>Peptide 5Tamra-RRRRRRRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTSVQTTSSGSGPFTDVR^-OH
<p>Peptide H-HTSVQTTSSGSGPFTDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^IADYNYKL-OH
<p>Peptide H-K^IADYNYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Src Homology 2 Domain (Biotinylated)
CAS:<p>Src Homology 2 Domain (Biotinylated) is a peptide that binds to the SH2 domain, which is a part of the Src family of kinases. This domain is important for cell signaling. The peptide can be used as a ligand in research or as a probe to detect and map protein-protein interactions. It can also be used to measure the activity of kinases and measure changes in protein-protein interactions. The peptide contains an N-terminal biotin tag, which allows it to be detected using streptavidin conjugated to an enzyme substrate, such as horseradish peroxidase.</p>Formula:C82H122N15O27SPPurezza:Min. 95%Peso molecolare:1,812.97 g/molCMVpp65 - 18 (HRGDNQLQVQHTYFT)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,844 g/molH-ILAGPAGDSNVVK^-OH
<p>Peptide H-ILAGPAGDSNVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CFP10 (71-85)
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H120N24O25Peso molecolare:1,721.91 g/molH-R^DSSWSETSEASYSGL-OH
<p>Peptide H-R^DSSWSETSEASYSGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSAELHVAHWNSAK^-OH
Peptide H-YSAELHVAHWNSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KLTWQELYQLKYKGI-NH2
<p>Peptide Ac-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDTLNLNLR^-OH
<p>Peptide H-VGDTLNLNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLNDINQAK^-OH
<p>Peptide H-VLNDINQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYHSHIDAPK^-OH
Peptide H-IYHSHIDAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKHWRSVYDEFGEL-OH
<p>Peptide Ac-CKHWRSVYDEFGEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLVMSGPYELK^-OH
<p>Peptide H-SLVMSGPYELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BKT140
CAS:<p>BKT140 is a potent and selective inhibitor of the CXCR4 receptor. It blocks binding of the chemokine stromal cell-derived factor-1α (SDF-1α) to its receptor, inhibiting cellular proliferation and inducing apoptosis in human cancer cells. BKT140 also inhibits the activity of cyclin-dependent kinases, which are enzymes that regulate the progress of cells through the cell cycle.</p>Formula:C97H144FN33O19S2Purezza:Min. 95%Peso molecolare:2,159.53 g/molCopeptin (rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C183H307N57O61Peso molecolare:4,281.8 g/molsCD40 Mouse
<p>sCD40 Mouse is a peptide that is used as a research tool to study the activation of CD40, an antibody that is used to activate CD40. sCD40 Mouse is an activator of CD40 and can be used in the inhibition of ion channels and protein interactions. It has a CAS number (1237-63-6) and acts as a ligand for receptor. sCD40 Mouse can be used in pharmacology to study protein interactions.</p>Purezza:Min. 95%Biot-NPSSLFRYLPSD-OH
<p>Peptide Biot-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PRCGVPDLGR-NH2
<p>Peptide Ac-PRCGVPDLGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQDFVQWL^MNT-OH
<p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TBTU Reagent
CAS:<p>TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).</p>Formula:C11H16N5OBF4Purezza:Min. 95%Peso molecolare:321.08 g/molFibromodulin F4 226-235 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FQNALLVR^-OH
Peptide H-FQNALLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CREBtide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C73H129N29O19Peso molecolare:1,717 g/molAc-PHSRN-NH2
Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAELEDEK^-OH
<p>Peptide H-VAELEDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-114
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,599.7 g/mol
