
Peptidi
Sottocategorie di "Peptidi"
Trovati 30060 prodotti di "Peptidi"
H-NDGYLMFQQVPMVEIDGMK^-OH
Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DSSVFAQ-OH
Peptide Ac-DSSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAGSSQHQER^-OH
Peptide H-GAGSSQHQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNTLTER^-OH
Peptide H-VNTLTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Ac-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that belongs to the group of ligands. It has been used as an inhibitor of ion channels and as an antibody for cell biology research. Ac-Asp-Glu-Val-Asp-H (aldehyde) is a potent activator of the class IB metabotropic glutamate receptors and has been shown to inhibit the activity of the Na+/K+ ATPase pump in rat brain synaptosomes. This peptide also binds to beta 2 adrenergic receptors with high affinity, but does not activate them.
Formula:C20H30N4O11Purezza:Min. 95%Peso molecolare:502.47 g/molH-DGQLTIK^-OH
Peptide H-DGQLTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Cys9] - β - Amyloid (1 - 9)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,079.1 g/molH-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH
Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DL^AFPGSGEQV^EK-OH
Peptide H-DL^AFPGSGEQV^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2
Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,619.8 g/molH-YGLVTYATYPK^-OH
Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTLYITR^-OH
Peptide H-DTLYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-LRELHLNNN-NH2
Peptide LCBiot-LRELHLNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKSRGDYMTMQIG-NH2
Peptide H-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIVYPWTQR^-OH
Peptide H-LLIVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^QCY-OH
Peptide H-A^QCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTEPISAESGEQVER^-OH
Peptide H-VTEPISAESGEQVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRQFKVVT-OH
Peptide H-YGGFL^RRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HNLGHGHK^-OH
Peptide H-HNLGHGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SPQLATLADEVSASLAKQGL-OH
Peptide Ac-SPQLATLADEVSASLAKQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Glt-Gly-Arg-MCA
CAS:Glt-Gly-Arg-MCA is a research tool that is used to activate the GLT1 receptor. It binds to the GLT1 receptor and activates it by binding to the Ligand-binding site. Glt-Gly-Arg-MCA has been shown to be an inhibitor of ion channels, such as Na+ channels, K+ channels, Ca2+ channels and voltage-gated Ca2+ channels. This product also binds to antibody molecules and inhibits their ability to bind with antigens or receptors. Glt-Gly-Arg-MCA has been used in research for Cell Biology, Pharmacology, and Life Science.Formula:C23H30N6O7Purezza:Min. 95%Peso molecolare:502.52 g/molBoc-Asp(OcHex)-OH
CAS:Boc-Asp(OcHex)-OH is a peptide with pharmacological and biological properties. It is an inhibitor of the phospholipase A2 enzyme, which plays a role in inflammation. Boc-Asp(OcHex)-OH also has been shown to activate the epidermal growth factor receptor (EGFR). This peptide has been used as a research tool for studying protein interactions and is also used as an antibody.
Formula:C15H25NO6Purezza:Min. 95%Peso molecolare:315.36 g/molNuclear-encoded Humanin [HN(N)] (Rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:4,311.08 g/molβ-Defensin-2 (Human) Antiserum
β-defensin-2 Antiserum is a research tool that can be used to study the interactions of ion channels, receptor and ligand. It is likely to be used in pharmacology and protein interactions. β-defensin-2 Antiserum is purified and has an affinity for antibody proteins.
Purezza:Min. 95%H-NEALIALLR^-OH
Peptide H-NEALIALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPFPGP^IP^NS-OH
Peptide H-YPFPGP^IP^NS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-I^LGGQE-OH
Peptide H-I^LGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRLDTETEGVPSTAIR^-OH
Peptide H-IRLDTETEGVPSTAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^APITSDPTEATAVGAVEASFK-OH
Peptide H-L^APITSDPTEATAVGAVEASFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELLESYIDGR^-OH
Peptide H-ELLESYIDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LRGGAPTK-NH2
Peptide Ac-LRGGAPTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.VIP Antagonist
CAS:VIP Antagonist is a drug that inhibits the α7 nicotinic acetylcholine receptor and has been shown to have inhibitory properties against cancer tissues. The drug blocks the response element for VIP, inhibiting cyclase activity. This prevents the production of VIP and other neuropeptides, which are involved in nerve cell growth and survival. VIP Antagonist also inhibits toll-like receptor signaling pathways by blocking TLR2 and TLR4, which are receptors on immune cells that recognize bacterial products. In addition, this drug binds to human immunoglobulin G (IgG) and prevents it from binding to its Fc receptor on immune cells, thus preventing IgG-mediated complement activation or antibody-dependent cellular cytotoxicity.
Formula:C154H257N49O40SPurezza:Min. 95%Peso molecolare:3,467.06 g/molHXB2 gag NO-43/aa169 - 183
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,563.8 g/molH-NTAYLQMNSL^R-OH
Peptide H-NTAYLQMNSL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKIQEFHVDGKE-NH2
Peptide Ac-CKIQEFHVDGKE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melittin
CAS:Melittin is a major component of bee venom that has been shown to have antibacterial efficacy against gram-positive bacteria, including methicillin-resistant Staphylococcus aureus. It also demonstrates anti-viral activity, for example it inhibits human immunodeficiency virus and herpes simplex virus. Furthermore it can be used in the treatment of inflammatory-related illnesses due to it inhibiting the phospholipase A2 enzyme. In addition to this Melittin's abaility to inhibit inflammatory mediators such as nitric oxide and cyclooxygenase-2 aids in the treatment of inflammatory diseases. As a result of Melittin having the capabilities of attacking lipid membranes and it surpressing COX-2 mRNA expression it can also be used in the treatment of tumours. The bound form of melittin is not toxic to mammalian cells, but it is toxic when it is released into the cell cytoplasm. Melittin has been shown to inhibit transcriptional regulation and locomotor activity in mice. This may be due to its ability to bind DNA, preventing transcription and translation of certain genes. Lastly It has strong hemolytic activity and been seen to increase insulin secretion via depolarization of pancreatic beta-cells. Melittin is a diverse peptide which can be used ina whole spectrum of research and therapeutic areas.
Formula:C131H229N39O31Purezza:Min. 95%Peso molecolare:2,846.47 g/molH-EDLTEIR^-OH
Peptide H-EDLTEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIEHIMEDLDTNADK^-OH
Peptide H-VIEHIMEDLDTNADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Cys(Trt)-Rink-Amide MBHA Resin
Fmoc-Cys(Trt)-Rink-Amide MBHA Resin is a peptide resin for the synthesis of peptides. It is used in the production of antibodies and other research tools. The product can be used as an inhibitor, activator, or ligand in cell biology and pharmacology research. Fmoc-Cys(Trt)-Rink-Amide MBHA Resin has a purity of at least 98% with a CAS number of 563925-03-8. This product is recommended for life sciences, ion channels, and antibody production.
Purezza:Min. 95%CMVpp65 - 101 (TSGSDSDEELVTTER)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,625.6 g/molLCBiot-DLDLEMLAPYIPMDDDFQL-OH
Peptide LCBiot-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Lys(Biotin)-OH
CAS:Fmoc-Lys(Biotin)-OH is a biotin-reactive derivative of the lysine amino acid. It is used to study the interactions between bacterial pathogens and human cells. Fmoc-Lys(Biotin)-OH has been shown to inhibit the growth of P. aeruginosa in thp-1 cells, which are immortalized human lung epithelial cells. This drug also inhibits the synthesis of proteins in the cell nuclei, which prevents the development of bacterial colonies on solubilized cell nuclei in human serum. The effects of Fmoc-Lys(Biotin)-OH have been observed using an unlabeled drug and preincubation with unlabeled protein to observe cytosolic protein synthesis inhibition. A confocal microscope was used to show that Fmoc-Lys(Biotin)-OH inhibited recombinant proteins that bind to human pathogens, such as Staphylococcus a
Formula:C31H38N4O6SPurezza:Min. 95%Peso molecolare:594.74 g/molHPV 16 E2 69-77 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fmoc-Pro-Rink-Amide MBHA Resin
Fmoc-Pro-Rink-Amide MBHA Resin is an amino acid resin that is used for the synthesis of peptides and proteins. It has a high purity and can be used as a research tool in the fields of pharmacology, protein interactions, receptor binding, ion channels, ligand binding, antibody production, or cell biology. Fmoc-Pro-Rink-Amide MBHA Resin is also an inhibitor of cyclic nucleotide phosphodiesterases. The chemical name for this product is 4-(2(2-(2-(3-(4-(dimethylamino)phenyl)amido)-6(1H)-pyridinyl)ethoxy)ethoxy)benzoic acid methyl ester hydrochloride.
Purezza:Min. 95%Boc-D-Tyr(Br-Z)-OH
CAS:Boc-D-Tyr(Br-Z)-OH is a sugar alcohol that has been shown to have anti-bacterial activity. It has been shown to inhibit the growth of dental plaque by inhibiting the synthesis of oligosaccharides, which are a major component of this type of biofilm. Boc-D-Tyr(Br-Z)-OH also inhibits transfer reactions in the bacterial cell wall, and is therefore able to prevent the formation of cell walls. This compound also has prebiotic properties, which may be due to its ability to stimulate insulin production. The enzyme responsible for Boc-D-Tyr(Br-Z)-OH synthesis is Tools for Peptide Synthesis (TPS). TPS catalyzes a chemical reaction that uses an acceptor molecule (e.g., ATP) and microbial metabolism as substrates. The product of this enzymatic reaction is fatty acids, which are then used in biosynthesis processes such as fatty acid
Formula:C22H24NO7BrPurezza:Min. 95%Peso molecolare:494.33 g/molH-AQAVHPGYGFLSENK^-OH
Peptide H-AQAVHPGYGFLSENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LVLRLRGG-OH
Peptide Ac-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DQGGELLSLR^-OH
Peptide H-DQGGELLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
p53 Protein, human, recombinant
The p53 protein is a transcription factor that regulates the cell cycle and suppresses tumor development. It is a type of tumor suppressor protein that helps prevent cells from becoming cancerous. The p53 protein is found in every human cell and has been shown to play an important role in apoptosis, or programmed cell death. The recombinant p53 protein can be used as an inhibitor for ion channels and as a research tool for studying protein interactions.Purezza:Purified By Proprietary Chromatographic TechniquesLeupeptin hemisulfate anhydrous
CAS:Leupeptin is a protease inhibitor that inhibits the activity of proteases in cells. It has been shown to inhibit transcriptional regulation and apoptosis pathway, as well as possessing anti-inflammatory properties. Leupeptin has been shown to have inhibitory properties against a variety of proteases, including group P2 metalloproteases, cathepsin D, and proteinase 3. This drug has also been shown to prevent neuronal death in experimental models by inhibiting cell lysis. Leupeptin binds to the active site of the enzyme by forming hydrogen bonds with conserved amino acid residues and steric interactions with nearby amino acid residues. The redox potentials of leupeptin are not known, but it is assumed that they are low enough for its antioxidant properties to be effective.
Formula:C20H38N6O4H2SOPurezza:Min. 90 Area-%Peso molecolare:475.6 g/molX-Neu5Ac
CAS:X-Neu5Ac is a peptide inhibitor of the protein interactions. It has been shown to activate the Ligand, which may be due to its ability to bind to the Receptor. This drug has been used as a research tool for studying ion channels and antibodies. X-Neu5Ac is a high purity product that can be used in life science research.
Formula:C19H22N2O9BrClPurezza:Min. 95%Peso molecolare:537.74 g/molH-MHVAQPAVVLASSR^-OH
Peptide H-MHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin, Canine, Rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C41H62N12O11Peso molecolare:899 g/molAc-CFLSPEELQSLVPLSD-NH2
Peptide Ac-CFLSPEELQSLVPLSD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGIIWVATEGALNTPK^-OH
Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Ile-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C13H25N3O4Peso molecolare:287.36 g/molH-SGGVVK^-OH
Peptide H-SGGVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGDGTVIL^^K^^-OH
Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTQSGSLLFIGR^-OH
Peptide H-DTQSGSLLFIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDNPNLPR^-OH
Peptide H-DDNPNLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
Peptide LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2
Peptide H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HLA leader peptide LVL (heavy-labeled)
Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack.Peptide H-VMAPRTLL^-OH is a heavy-labeled version of PP45242, and is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGFFYTPK^T-OH
Peptide H-RGFFYTPK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGYETFR^-OH
Peptide H-SGYETFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLYTDDAQQTEAHLEIR^-OH
Peptide H-YLYTDDAQQTEAHLEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bradykinin (1-7)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C35H52N10O9Peso molecolare:756.87 g/molH-ALVTDADNVIPK^-OH
Peptide H-ALVTDADNVIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LMP2 (236 - 244) , RRR
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C56H99N25O11Peso molecolare:1,298.5 g/molAc-RKRR-NH2
Peptide Ac-RKRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gly-Val-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C12H23N3O4Peso molecolare:273.33 g/molH-RRRRR-NH2
Peptide H-RRRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELFSYLIEK^-OH
Peptide H-ELFSYLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 19
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,785.1 g/molSeptin 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-TLSDYNIQK^ESTLHLVLR^-OH
Peptide H-TLSDYNIQK^ESTLHLVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Tyr-AMC
CAS:H-Tyr-AMC is a synthetic substrate that is used in the study of serine proteases. It is reversibly bound to Sephadex G-100 and is hydrolyzed by protease enzymes in an acidic environment, generating an AMC chromatographic peak. This product has been shown to inhibit serine protease activity and, when incubated with the enzyme, reduces the hydrolysis of synthetic substrates. Synthetic H-Tyr-AMC can be used to study the inhibition of serine proteases by various inhibitors and their binding sites on the enzyme.Formula:C19H18N2O4Purezza:Min. 99 Area-%Colore e forma:White PowderPeso molecolare:338.36 g/molH-FSGVPDR^-OH
Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLGASVLGL^-OH
Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGISPFHEHAEVVFTANDSGPR^-OH
Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELRRKMMYM-NH2
Peptide H-ELRRKMMYM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aoa-THRPPMWSPVWP-NH2
Peptide Aoa-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Lys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C41H75N11O11Peso molecolare:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNFGDDIPSALR^-OH
Peptide H-LNFGDDIPSALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHLTTGGDVR^-OH
Peptide H-SHLTTGGDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-D^LDVPIPGRFDRRVSVAAE-OH
Peptide H-D^LDVPIPGRFDRRVSVAAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-29
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,554.6 g/molH-NFP^SPVDAAFR^-OH
Peptide H-NFP^SPVDAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,618.8 g/molCMVpp65 - 33 (HHYPSAAERKHRHLP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,836.1 g/molBiot-RDVYEEDSYVKRSQG-NH2
Peptide Biot-RDVYEEDSYVKRSQG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILTVDELLAIR^-OH
Peptide H-GILTVDELLAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Ile-OH • 1/2 H2O
CAS:Boc-Ile-OH • 1/2 H2O is a synthetic monomer that can be used in peptide synthesis. It is detectable under microscopy and chromatography, and is a component of the Tool for Peptide Synthesis. Boc-Ile-OH • 1/2 H2O has a nature that is synthetic and industrialized, an amino acid composition that is synthetic, and can be used as a monomer in polymerization reactions. This compound also shows enhancement of acidic radical chain reactions. The chromatographic method used to identify this compound utilizes TLC on alumina plates, which are then sprayed with ninhydrin reagent or phosphomolybdic acid reagent. The plate is heated until the solvent evaporates and the residue remains on the plate.
Formula:C11H21NO4H2OPurezza:Min. 95%Peso molecolare:240.3 g/molH-SNL-NH2
Peptide H-SNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQIIPK^-OH
Peptide H-IQIIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2
Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLEGSDDAVLLQR^-OH
Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-FRHD-OH
Peptide pE-FRHD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2
CAS:Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2 is a synthetic peptide substrate that is used in the study of proteolytic enzymes. It has been shown to be an inhibitor of collagenase, MMPs, and stromelysin. This product can be used to determine the kinetic parameters for these enzymes. Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2 can be used as a substrate for enzyme catalysis studies, as well as for research on cancer and collagen.
Formula:C49H68N14O12SPurezza:Min. 95%Peso molecolare:1,077.24 g/molCMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,632.8 g/molH-NAVPITPTLNR^-OH
Peptide H-NAVPITPTLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
δ Sleep Inducing Peptide
Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C35H48N10O15Peso molecolare:848.83 g/molThr-Ala-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H25N3O5Peso molecolare:303.35 g/molH-IADFGLARLIEDNEYTARQGAK^-OH
Peptide H-IADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RDKVESQVESAPKEC-NH2
Peptide Ac-RDKVESQVESAPKEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVPAFFWTDK^-OH
Peptide H-SVPAFFWTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,771 g/molH-NIYLNSGLTSTK^-OH
Peptide H-NIYLNSGLTSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HCMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-LTYYTPEYETK^-OH
Peptide H-LTYYTPEYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAVEVLK^-OH
Peptide H-NAVEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VFSLQWGEVK^-OH
Peptide H-VFSLQWGEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH
Peptide H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:3,247.64 g/molH-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQVSLTCLVK^-OH
Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QYFFET^K-OH
Peptide H-QYFFET^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLVLDTDYK^-OH
Peptide H-VLVLDTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLFGYPVYV^-OH
Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNHTASILDR^-OH
Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAPVNISSSDLTGR^-OH
Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LCDSGELVAIK^-OH
Peptide H-LCDSGELVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RPHTDVEKILPKGISC-NH2
Peptide Ac-RPHTDVEKILPKGISC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β-Amyloid (1-18)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,167.3 g/molCMVpp65 - 59 (EDVPSGKLFMHVTLG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,629.9 g/molSARS-CoV-2 ORF1ab (3183-3191)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-ENAGEDPGLAR^-OH
Peptide H-ENAGEDPGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGLKPEQA-NH2
Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Parathyroid Hormone (PTH) (Active)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Ac-SRT-NH2
Peptide Ac-SRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HER2/neu(654-662) GP2
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C42H77N9O11Peso molecolare:884.12 g/molCbz-LLE-AMC
Peptide Cbz-LLE-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNVQGDTK^-OH
Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,655 g/molH-GGLPLEEVTVAEVLAAR^-OH
Peptide H-GGLPLEEVTVAEVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QIVLSQSPAILSASPGEK^-OH
Peptide H-QIVLSQSPAILSASPGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QVLQVTPFAER-OH
Peptide H-QVLQVTPFAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C58H94N16O17Peso molecolare:1,287.49 g/molH-YTIAALLSPYSYSTTAVVTNPK^-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TDTGVSLQTYDDLLAK^-OH
Peptide H-TDTGVSLQTYDDLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGSHHTASPWNLSPFSK^-OH
Peptide H-ALGSHHTASPWNLSPFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 75
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,891 g/molH-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PB1(703 - 711), Influenza
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C45H75N15O13Peso molecolare:1,034.19 g/molLCBiot-ENPVVHFFKNIVTPR-OH
Peptide LCBiot-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-mini-PEG-2-ClTrt-Resin (100-200 mesh) 1% DVB
crosslinkage: 1% DVBResin: 100 - 200 meshsubstitution: ca 0.7 meq/gPurezza:Min. 95%H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-HWSYGLRPG-OH
Peptide pE-HWSYGLRPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SGVYKVAYDWQH-NH2
Peptide LCBiot-SGVYKVAYDWQH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CNPHPYNEGYVY-NH2
Peptide H-CNPHPYNEGYVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSGSTSTSR^-OH
Peptide H-VTSGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFTLLDPK^-OH
Peptide H-TFTLLDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WMDF^-NH2
Peptide H-WMDF^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:606.7 g/molHIV-1 Nef 92-100 (HLA-B*40:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-THFPQFSYSASIRE^-OH
Peptide H-THFPQFSYSASIRE^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-DRFSVNLDVKHFSPEELKVKV-OH
Peptide LCBiot-DRFSVNLDVKHFSPEELKVKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTTHPLAK^-OH
Peptide H-VTTHPLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNWYV^DGVEVHNAK^-OH
Peptide H-FNWYV^DGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVLLNAIYLSAK^-OH
Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-THLAPYSDEL^R-OH
Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GNLLINIR^-OH
Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESSAAKLKRKYWWK^NLK^-OH
Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,685.9 g/molH-NITEIADLTQK^-OH
Peptide H-NITEIADLTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIAPPERK^-OH
Peptide H-IIAPPERK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,356.5 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Ac-CDDINVDRENRRELVAK-NH2
Peptide Ac-CDDINVDRENRRELVAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tirzepatide sodium
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Formula:C225H348N48O68•xNaPurezza:Min. 95 Area-%Colore e forma:PowderRanatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C61H85N16O13SPeso molecolare:1,281.5 g/molHLA-A2 140-149 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-IQIDPV^K-OH
Peptide H-IQIDPV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FASFEAQGALANIAVDK^-OH
Peptide H-FASFEAQGALANIAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LASAYGAR^-OH
Peptide H-LASAYGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSALFYQK^-OH
Peptide H-SSALFYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TMLLQPAGSLGSYSYR^-OH
Peptide H-TMLLQPAGSLGSYSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AKKGYY-NH2
Peptide Ac-AKKGYY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APGLTQALNTK^-OH
Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
M 1145
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C128H205N37O32Peso molecolare:2,774.26 g/molAc-CSEGEKARKNIVLARRRP-NH2
Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^^G^^G-OH
Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TTAW-NH2
Peptide Ac-TTAW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FTVLTES^AAK^-OH
Peptide H-FTVLTES^AAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGESEQIIVTR^-OH
Peptide H-FGESEQIIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK^-OH
Peptide H-VDPVNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLVVSDLFTER^-OH
Peptide H-SLLVVSDLFTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TVDRAEVPPLFWKPC-NH2
Peptide Ac-TVDRAEVPPLFWKPC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSTVAGESGSADTVR^-OH
Peptide H-FSTVAGESGSADTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
