
Peptidi
Sottocategorie di "Peptidi"
Trovati 30060 prodotti di "Peptidi"
CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,694.1 g/molHXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,800.1 g/molH-SILKV-NH2
Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,663.8 g/molH-YGIENVK^-OH
Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLNQELR^-OH
Peptide H-VLNQELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LRPVAAEVYGTER^-OH
Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLYSALANK^-OH
Peptide H-QLYSALANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tesamorelin acetate
CAS:Tesamorelin acetate is a synthetic peptide that functions as a growth hormone-releasing hormone (GHRH) analog. It is derived through complex chemical synthesis techniques that mimic the natural GHRH sequences found in the human body. The mode of action of Tesamorelin involves binding to GHRH receptors in the pituitary gland, which stimulates the secretion of growth hormone. This increase in growth hormone levels subsequently enhances insulin-like growth factor-1 (IGF-1) production, leading to various metabolic effects.Tesamorelin acetate is primarily utilized in the medical field for the reduction of excess visceral adipose tissue in patients with HIV-associated lipodystrophy. This condition leads to the abnormal distribution of body fat, posing significant health risks. By modulating the growth hormone axis, Tesamorelin helps in decreasing visceral fat accumulation, thereby improving body composition and metabolic health in affected individuals. It is important to note that the use of Tesamorelin should be carefully monitored within clinical settings to assess efficacy and safety.
Formula:C221H366N72O67SPurezza:Min. 98 Area-%Colore e forma:PowderH-TTPPV^LDSDGSFFLYSR^-OH
Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-I^L^AR-OH
Peptide H-I^L^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ELSWSADSIRLQISNPD-NH2
Peptide Ac-ELSWSADSIRLQISNPD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KITDFGRAK^-OH
Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLYSGLNQR^-OH
Peptide H-DLYSGLNQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CDLIKALGSPSVLP-NH2
Peptide Ac-CDLIKALGSPSVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KALNK^-OH
Peptide H-KALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGPLV^EQGR-OH
Peptide H-LGPLV^EQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 66 (QPFMRPHERNGFTVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,829.1 g/mol(Des-Asp1)-Angiotensin I
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C58H84N16O11Peso molecolare:1,181.42 g/molH-VVVGADGVGK^-OH
Peptide H-VVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISLPESLK^-OH
Peptide H-ISLPESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV core protein (128-140)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C66H103N17O17Peso molecolare:1,406.64 g/molH-GVFELSDEK^-OH
Peptide H-GVFELSDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-DAEFRHDSGYE-OH
Peptide LCBiot-DAEFRHDSGYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239-2
Peptide SIVmac239-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C70H123N19O25Peso molecolare:1,630.87 g/molH-AAFDDAIAELDTLSEESYK^-OH
Peptide H-AAFDDAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B2R (54-62)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VGLPINQR^-OH
Peptide H-VGLPINQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTDILAAFR^-OH
Peptide H-DTDILAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YG^GFL-OH
Peptide H-YG^GFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATASRGASQAGAPQGC-NH2
Peptide H-ATASRGASQAGAPQGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSP-NH2
Peptide H-SLSLSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-PKYVKQNTLKLAT-OH
Peptide Fluor-PKYVKQNTLKLAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLYASSPGGVYATR^-OH
Peptide H-SLYASSPGGVYATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVESLFPEEAETPGSAVR^-OH
Peptide H-TVESLFPEEAETPGSAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.VL9, RT, (346 - 354)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C53H78N10O17SPeso molecolare:1,159.33 g/molAc-SGDQRQVDLIPKKAT-NH2
Peptide Ac-SGDQRQVDLIPKKAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YVLDDEYTSSVGSK^-OH
Peptide H-YVLDDEYTSSVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-RIIDLLWRVRRPQKPKFVTVWVR-OH
Peptide Myr-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WELGEGAFGK^-OH
Peptide H-WELGEGAFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEPQTVPEMPGETPPLSPIDMESQER^-OH
Peptide H-EEPQTVPEMPGETPPLSPIDMESQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVGAIYPGNGDTSYNQK^-OH
Peptide H-GLEWVGAIYPGNGDTSYNQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIAEAYLGK^-OH
Peptide H-EIAEAYLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVNEEALR^-OH
Peptide H-FVNEEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-COV-2 S Protein (934 - 947)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,377.53 g/molH-LLLQVQHASK^-OH
Peptide H-LLLQVQHASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-75/aa297 - 311
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,812 g/molSIVmac239 - 65
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,798.2 g/molH-SFEDIHHYREQIK^-OH
Peptide H-SFEDIHHYREQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAVQATKPDMR^-OH
Peptide H-DAVQATKPDMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTIGEGQQHHLGGA^K^QA^GDV-OH
Peptide H-LTIGEGQQHHLGGA^K^QA^GDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DFLAGGIAAAISK^-OH
Peptide H-DFLAGGIAAAISK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVTFISYDGNNK^-OH
Peptide H-GLEWVTFISYDGNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGEVIVTK^-OH
Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GKKPSGPNPGGNN-OH
Peptide Biot-GKKPSGPNPGGNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLVK^-OH
Peptide H-GLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPGF^-OH
Peptide H-RPPGF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-LRRFSTAPFAFIDINDVINF-NH2
Peptide 5Fam-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLNSLSELEVK^-OH
Peptide H-NLNSLSELEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
13C-PT630
Peptide 13C-PT630 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRR^I-OH
Peptide H-YGGFLRR^I-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 envelope - 85
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:2,160.4 g/molAc-CIANHTGVDIHRNGDFQKNG-NH2
Peptide Ac-CIANHTGVDIHRNGDFQKNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^L^IYWASTR^-OH
Peptide H-L^L^IYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYLILEYAPLGTVYR^-OH
Peptide H-VYLILEYAPLGTVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,697.9 g/molBiot-PICTF-OH
Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILLPQK^-OH
Peptide H-GILLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FGFR substrate
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,681.3 g/molH-SLHTLFGDK^-OH
Peptide H-SLHTLFGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TNFDNDIALVR^-OH
Peptide H-TNFDNDIALVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPDIYNPQAGSLK^-OH
Peptide H-SPDIYNPQAGSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GIP (3 - 42), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C214H324N58O63SPeso molecolare:4,749.38 g/molH-GVASLFAGR^-OH
Peptide H-GVASLFAGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGVLYVGSK^-OH
Peptide H-EGVLYVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAEIAR^-OH
Peptide H-LQDAEIAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MART-1 (26-35) (human)
CAS:Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Formula:C42H74N10O14Peso molecolare:943.11 g/molH-ELTIGSK^-OH
Peptide H-ELTIGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aoa-KKSL-OH
Peptide Aoa-KKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVLAYEPVWAIGTGK^-OH
Peptide H-VVLAYEPVWAIGTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-99/aa393 - 407
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,663.9 g/molGP120 - W61D - 57
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,621.9 g/molH-ALYVDSLFF^L-OH
Peptide H-ALYVDSLFF^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 92
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,565.9 g/molCMVpp65 - 69 (RNGFTVLCPKNMIIK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,655.2 g/molH-F^VAPFPE-OH
Peptide H-F^VAPFPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PALEDLR^-OH
Peptide H-PALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSAVLQSGFRK-NH2
Peptide H-TSAVLQSGFRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BrAc-TWPKHFDKHTFYSILKLGKH-NH2
Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:2,604.86 g/molCMVpp65 - 8 (RGDTPVLPHETRLLQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,732 g/molSIVmac239 - 60
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,715.9 g/molH-HLDDLK^^-OH
Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPTFIPAPIQAK^-OH
Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLAEVATGEK^-OH
Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELHHLQEQNVSNA^FLDK^-OH
Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTAGVSPK^-OH
Peptide H-YTAGVSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ILRTQESEC-NH2
Peptide Ac-ILRTQESEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GQLIDSMANSFVGTR-NH2
Peptide Ac-GQLIDSMANSFVGTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VQIVYKPVDLSK^-OH
Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVEAFGGATK^-OH
Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SPeso molecolare:1,583.8 g/molAc-SDKNEKSHKYETLNISKC-NH2
Peptide Ac-SDKNEKSHKYETLNISKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DREQAPNL^VY-OH
Peptide H-DREQAPNL^VY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molLCBiot-NLRKSGTLGHPGSL-OH
Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLQPFPQPELPY-OH
Peptide H-QLQPFPQPELPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C194H297N55O56SPeso molecolare:4,327.9 g/molAc-CLSHPYLYAQLDGPR-NH2
Peptide Ac-CLSHPYLYAQLDGPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 16 (YTPDSTPCHRGDNQL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molH-ITLYLK^-OH
Peptide H-ITLYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β-Amyloid (1-38)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C184H277N51O56SPeso molecolare:4,131.6 g/molB-Ahx-AEEEYFFLFA-NH2
Peptide B-Ahx-AEEEYFFLFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HBV polymerase (455-463)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C46H79N15O12Peso molecolare:1,034.24 g/molFluor-VPMLK-OH
Peptide Fluor-VPMLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFYLAGGVPR^-OH
Peptide H-AFYLAGGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,765.1 g/molH-ILDFGLAR^-OH
Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-HHHHHHC-OH
Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VGVAPG-NH2
Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aoa-DYKDDDDK-OH
Peptide Aoa-DYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDIER^-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EVGDWRK^-OH
Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPVSDR^-OH
Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRAELEKHGYKMETS
Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolMelanocyte Protein PMEL 17 (44-59) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C95H137N27O28Peso molecolare:2,105.3 g/molH-VYIHP^F-OH
Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSVFPLAPSSR^-OH
Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR^-OH
Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTVDTTLAGYHLPK^-OH
Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TENNDHINLK^-OH
Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPEQTQGNFGDQELIR^-OH
Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK^-OH
Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQTVGGVNYFFDVEVGR^-OH
Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL^-OH
Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVGAVLK^-OH
Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNLEAL^EDFEK-OH
Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin II, ala(8)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C44H67N13O12Peso molecolare:970.1 g/molH-LNDTTLQVLNTWYTK^-OH
Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ASQETFG-NHMe
Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QMVQQFK^-OH
Peptide H-QMVQQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,657.9 g/molH-GPGPGGPGGAGVAR^-OH
Peptide H-GPGPGGPGGAGVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAAAAAAR-NH2
Peptide H-RAAAAAAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^SQLQTYMI^-OH
Peptide H-L^SQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KEELDKYFKNHTSPDVDLG-OH
Peptide LCBiot-KEELDKYFKNHTSPDVDLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Recombinant Apis mellifera carnica Defensin-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-GMNYLEDR^-OH
Peptide H-GMNYLEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-105
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,717.9 g/molLeucyl-Phenylalanyl-Isoleucyl-Glutamyl-Tryptophyl-Leucyl-Lysine Trifluoroacetate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C49H73N9O10Peso molecolare:948.17 g/molHLA leader peptide LIL
Peptide H-VMAPRTLIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-79/aa313 - 327
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,761 g/molH-LPLAYPQWYYANSEEWTFPTE-NH2
Peptide H-LPLAYPQWYYANSEEWTFPTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVAR^-OH
Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQTFFNPRT^FGSGE-OH
Peptide H-YQTFFNPRT^FGSGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLMWITQV^-OH
Peptide H-SLLMWITQV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFLEPTR^-OH
Peptide H-LFLEPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DEPPQSPWDR^-OH
Peptide H-DEPPQSPWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RARADADARARADADA-NH2
Peptide Ac-RARADADARARADADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSEGAGLQLQK^-OH
Peptide H-VTSEGAGLQLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GGRGGFGGRGGFGGRGGFG-NH2
Peptide Biot-GGRGGFGGRGGFGGRGGFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFESLK^-OH
Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-13
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,603.8 g/molCys-Kemptide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C35H66N14O10S1Peso molecolare:875.1 g/molSARS-CoV-2 Antigen Peptide NCAP (ILLNKHID)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H76N12O12Peso molecolare:965.22 g/molBiot-MHRSDLMSAAVR-OH
Peptide Biot-MHRSDLMSAAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSPVLIDFFEDTER^-OH
Peptide H-DSPVLIDFFEDTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 51 (AHELVCSMENTRATK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,689.9 g/molH-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^QQPYPQPQPQY-OH
Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDAPIGK^-OH
Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Hemoglobin β chain [133-146]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C66H104N20O17Peso molecolare:1,449.6 g/molH-EKAHDGGR^YYRA-OH
Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGQEIEVRPGIVSK^-OH
Peptide H-VGQEIEVRPGIVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
S961 TFA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C211H297N55O71S2Peso molecolare:4,804.13 g/molLCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH
Peptide LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TELLPGDRDNLAIQTR^-OH
Peptide H-TELLPGDRDNLAIQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASHLGLAR^-OH
Peptide H-ASHLGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Des-Glu²²)-Amyloid β-Protein (1-42)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C198H304N54O57SPeso molecolare:4,384.99 g/molH-APPDNLPSPGGSR^-OH
Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-KYEQYIKW-NH2
Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
