Peptidi
Sottocategorie di "Peptidi"
Trovati 29863 prodotti di "Peptidi"
Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 82
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,569.9 g/molH-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH
Peptide H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYQAVTTTL-OH
Peptide H-KYQAVTTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LL-37 ( Human)
CAS:LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production. LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which mayFormula:C205H340N60O53Purezza:Min. 95%Peso molecolare:4,493.3 g/molH-IEIYPTSLTK^-OH
Peptide H-IEIYPTSLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 37
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,731.1 g/molH-DSTYSLSSTLTLSK^-OH
Peptide H-DSTYSLSSTLTLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SGVYKVAYDWQH-NH2
Peptide LCBiot-SGVYKVAYDWQH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IADFGLARLIEDNEYTARQGAK^-OH
Peptide H-IADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 43 (TRQQNQWKEPDVYYT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,956.1 g/molH-GILTVDELLAIR^-OH
Peptide H-GILTVDELLAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RDKVESQVESAPKEC-NH2
Peptide Ac-RDKVESQVESAPKEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Cys(Trt)-OH
CAS:Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.Formula:C37H31NO4SPurezza:Min. 98.0 Area-%Peso molecolare:585.71 g/molH-WMDF^-NH2
Peptide H-WMDF^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:606.7 g/molHLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,093.3 g/molH-ATNYNAGDR^-OH
Peptide H-ATNYNAGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLEGSDDAVLLQR^-OH
Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-FRHD-OH
Peptide pE-FRHD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,632.8 g/molHIV-1 Nef 92-100 (HLA-B*40:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-THFPQFSYSASIRE^-OH
Peptide H-THFPQFSYSASIRE^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bivalirudin
CAS:Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.
Formula:C98H138N24O33Purezza:Min. 95%Peso molecolare:2,180.33 g/molLCBiot-VTSAPDTRPAPGSTAPPAHG-OH
Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTTHPLAK^-OH
Peptide H-VTTHPLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EL^SEALGQIFDSQR^-OH
Peptide H-EL^SEALGQIFDSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,771 g/molHLA leader peptide LFL
Peptide H-VMAPRTLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RTARSLRRRFT-NH2
Peptide H-RTARSLRRRFT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTYYTPEYETK^-OH
Peptide H-LTYYTPEYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNWYV^DGVEVHNAK^-OH
Peptide H-FNWYV^DGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,685.9 g/molH-LLGDFFR^-OH
Peptide H-LLGDFFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^TVDK-OH
Peptide H-L^TVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Parathyroid Hormone (PTH) (Active)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-AVTEQGAELSNEER^-OH
Peptide H-AVTEQGAELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RADARADARADARADA-NH2
Peptide Ac-RADARADARADARADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IIAPPERK^-OH
Peptide H-IIAPPERK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QYFFET^K-OH
Peptide H-QYFFET^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGAVYSSDEAL^IPIR-OH
Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,655 g/molOvalbumin (257-264) (chicken) acetate salt
CAS:Ovalbumin (257-264) is an acetate salt of a fragment of the protein ovalbumin.Formula:C45H74N10O13Purezza:Min. 95%Colore e forma:SolidPeso molecolare:963.13 g/molTirzepatide sodium
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Formula:C225H348N48O68•xNaPurezza:Min. 95 Area-%Colore e forma:PowderH-LFEVIETEK^-OH
Peptide H-LFEVIETEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RPHTDVEKILPKGISC-NH2
Peptide Ac-RPHTDVEKILPKGISC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Amyloid (1-18)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,167.3 g/molSARS-CoV-2 ORF1ab (3183-3191)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ENAGEDPGLAR^-OH
Peptide H-ENAGEDPGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGLKPEQA-NH2
Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SRT-NH2
Peptide Ac-SRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cbz-LLE-AMC
Peptide Cbz-LLE-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNVQGDTK^-OH
Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSALFYQK^-OH
Peptide H-SSALFYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuropeptide S (Human)
CAS:Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.Formula:C93H155N31O28SPurezza:Min. 95%Peso molecolare:2,187.5 g/molH-VTSGSTSTSR^-OH
Peptide H-VTSGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tirzepatide
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Formula:C225H348N48O68Purezza:Min. 95%Colore e forma:PowderPeso molecolare:4,813 g/molH-LSLVPDSEQGEAILPR^-OH
Peptide H-LSLVPDSEQGEAILPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
M 1145
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C128H205N37O32Peso molecolare:2,774.26 g/molH-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^^G^^G-OH
Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NITEIADLTQK^-OH
Peptide H-NITEIADLTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PB1(703 - 711), Influenza
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C45H75N15O13Peso molecolare:1,034.19 g/molH-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FK18
FK18 is a basic fibroblastic growth factor that has been shown to promote neuronal survival and is neuroprotective. It also can prevent glutamate-induced neurotoxicity in the central nervous system (CNS) by inhibiting glutamate release from the synaptic cleft, which leads to neuronal death. FK18 has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins and other inflammatory mediators. FK18 has also been shown to reduce necrotic cell death by decreasing mitochondrial membrane potential.Formula:C107H155N31O31Purezza:Min. 95%Peso molecolare:2,371.62 g/molH-LLVYTILPDGEVVGDSAK^-OH
Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LASAYGAR^-OH
Peptide H-LASAYGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TTAW-NH2
Peptide Ac-TTAW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 119
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,909.2 g/molH-HSVVVPYEPPEAGSEYTTIHYK^-OH
Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DRVYIHPF-OH
Angiotensin II plays an essential role in the maintenance of blood pressure and blood volume. It is a peptide hormone that causes vasoconstriction, a sensation of thirst, and stimulation of the adrenal cortex and aldosterone.
Derived from the cleavage of angiotensin I by the angiotensin converting enzyme, angiotensin II is involved in the renin-angiotensin system (RAS).
Angiotensin II is the subject of much scientific research and is already the target of many anti-hypertensive drugs (ACE inhibitors, ARBs or AT1 receptor antagonists).H-FTVLTES^AAK^-OH
Peptide H-FTVLTES^AAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGESEQIIVTR^-OH
Peptide H-FGESEQIIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK^-OH
Peptide H-VDPVNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TentaGel® HL-NH2 Resin
TentaGel resin; constructed with a backbone of low cross-linked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. TentaGel; HL (High Load) (mean particle size 110 µm: capacity 04-06 meq/g)Purezza:Min. 95%H-TFTLLDPK^-OH
Peptide H-TFTLLDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLVVSDLFTER^-OH
Peptide H-SLLVVSDLFTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TMLLQPAGSLGSYSYR^-OH
Peptide H-TMLLQPAGSLGSYSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ile-Pro-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C17H31N3O4Peso molecolare:341.45 g/molH-LVLLNAIYLSAK^-OH
Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-THLAPYSDEL^R-OH
Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GNLLINIR^-OH
Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESSAAKLKRKYWWK^NLK^-OH
Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,502.8 g/molH-GAL^^QNIIPASTGAAK-OH
Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AEEDEILNR^-OH
Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,356.5 g/molHIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C73H126N26O18Peso molecolare:1,656 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Asp(2-ClTrt-Resin)-OtBu (α Ester)
H-Asp(2-ClTrt-Resin)-OtBu (α Ester) is a building block that is used in peptide synthesis. It can be resubstituted with the amino acid, aspartic acid, and used in the formation of peptides. This resin is insoluble in water and soluble in dichloromethane and dimethylformamide. The H-Asp(2-ClTrt-Resin)-OtBu (α Ester) can also be used to form disulfides or thioethers.Purezza:Min. 95%Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Ac-CDDINVDRENRRELVAK-NH2
Peptide Ac-CDDINVDRENRRELVAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ranatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C61H85N16O13SPeso molecolare:1,281.5 g/molHLA-A2 140-149 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
HXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,663.8 g/molH-YGIENVK^-OH
Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-F^R^-OH
Peptide H-F^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSESGLPSTR^-OH
Peptide H-TSESGLPSTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Enterotoxin STp
CAS:Enterotoxin STp is an Escherichia coli Enterotoxin, with the following disulfide bonds: Cys5 and Cys10; Cys6 and Cys14; Cys9 and Cys17 and available as the trifluoroacetate salt.
One-Letter-Code: H-NTFYCCELCCNPACAGCY-OHFormula:C81H110N20O26S6Purezza:Min. 95%Peso molecolare:1,972.26 g/molIL 6 Mouse
IL-6 Mouse is a recombinant protein that belongs to the cytokine family. It has been shown to activate IL-6 receptor. This receptor is a member of the GPCR family and possesses seven transmembrane domains with a large extracellular loop between TM2 and TM3. The extracellular domain contains binding sites for two different classes of ligands, including peptides and proteins. IL-6 Mouse is an antibody against IL-6 receptor that can be used as a research tool in pharmacology, protein interactions, cell biology, or immunology. IL-6 Mouse is produced by high purity process and it contains no detectable levels of endotoxin or pyrogens.Purezza:>96% By Sds-Page And Rp-Hplc.Fmoc-Gly-Arg(Pbf)-OH
Fmoc-Gly-Arg(Pbf)-OH is a dipeptide building block that can be used in the synthesis of peptides. It is an analogue of Gly-Pro and Arg(Pbf)-OH, which are also dipeptide building blocks. The properties of Fmoc-Gly-Arg(Pbf)-OH make it suitable for peptide synthesis through solid phase chemistry. Dipeptides are important tools for the synthesis of peptides, as they are easy to handle and modify. They are also used as building blocks for constructing more complex molecules such as proteins or nucleic acids.Formula:C36H43N5O8SPurezza:Min. 95%Peso molecolare:705.84 g/molProtein Kinase C (19-36)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C93H159N35O24Peso molecolare:2,151.51 g/molH-APGLTQALNTK^-OH
Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASDPSLK^-OH
Peptide H-ASDPSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALAENNLNLPK^-OH
Peptide H-EALAENNLNLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans
CAS:TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.Formula:C70H104N22O18SPurezza:Min. 95%Peso molecolare:1,573.81 g/molAc-CSEGEKARKNIVLARRRP-NH2
Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a peptide that binds to the integrin αvβ3, which is expressed on many types of cancer cells. This binding causes cell death by apoptosis. H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 also has the potential to be used as an imaging agent for tumor detection and diagnosis.Formula:C67H102N20O22Purezza:Min. 95%Peso molecolare:1,539.68 g/molTesamorelin acetate
CAS:Tesamorelin acetate is a synthetic peptide that functions as a growth hormone-releasing hormone (GHRH) analog. It is derived through complex chemical synthesis techniques that mimic the natural GHRH sequences found in the human body. The mode of action of Tesamorelin involves binding to GHRH receptors in the pituitary gland, which stimulates the secretion of growth hormone. This increase in growth hormone levels subsequently enhances insulin-like growth factor-1 (IGF-1) production, leading to various metabolic effects.Tesamorelin acetate is primarily utilized in the medical field for the reduction of excess visceral adipose tissue in patients with HIV-associated lipodystrophy. This condition leads to the abnormal distribution of body fat, posing significant health risks. By modulating the growth hormone axis, Tesamorelin helps in decreasing visceral fat accumulation, thereby improving body composition and metabolic health in affected individuals. It is important to note that the use of Tesamorelin should be carefully monitored within clinical settings to assess efficacy and safety.
Formula:C221H366N72O67SPurezza:Min. 98 Area-%Colore e forma:PowderH-TTPPV^LDSDGSFFLYSR^-OH
Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Purotoxin-1
CAS:Purotoxin-1 is a peptide that belongs to the group of activators. It is an inhibitor of potassium channels which are involved in the regulation of excitability and repolarization of cells. Purotoxin-1 has been shown to block the binding of calcium ions to the N-type voltage-gated calcium channels, leading to decreased intracellular calcium levels and reduced neurotransmitter release. Purotoxin-1 has been shown to inhibit tumor growth in vivo, which may be due to its ability to inhibit protein interactions with cell surface receptors.Formula:C155H248N50O48S8Purezza:Min. 95%Peso molecolare:3,836.5 g/molH-AVPI-NH2
Peptide H-AVPI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Lys(Boc)-OH
CAS:Fmoc-D-Lys(Boc)-OH is a building block for the synthesis of peptides. It can be used to synthesize chains that are up to 17 amino acids long. Fmoc-D-Lys(Boc)-OH is a protected amino acid with an active group on the alpha carbon and has been used in the synthesis of ganirelix acetate, a peptide that is used in the treatment of prostate cancer. The Boc group is an organic compound that protects the lysine side chain from reacting with other compounds. The Fmoc group is also an organic compound, which helps to protect the side chain from reactions with other compounds. These groups are removed at different stages of synthesis, depending on what type of reaction needs to take place next.
Formula:C26H32N2O6Purezza:Min. 95%Peso molecolare:468.55 g/molAbz-Ser-Pro-Tyr(NO2)-OH
Abz-Ser-Pro-Tyr(NO2)-OH is a peptide that has been shown to be an angiotensin I converting enzyme II (ACE) substrate and an inhibitor of ACE. It also inhibits the release of renin from the juxtaglomerular apparatus, which is needed for the production of angiotensin II. This peptide is used in biochemical research and as a standard for measuring enzymatic activity.Formula:C24H27N5O9Purezza:Min. 95%Peso molecolare:529.51 g/molH-NQEQVSPLTLLK^-OH
Peptide H-NQEQVSPLTLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-118
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,724.9 g/molSIVmac239 - 117
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,718.1 g/molAc-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLQEYQDLLNVK^-OH
Peptide H-HLQEYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Asp(OtBu)-Rink-Amide MBHA Resin
Fmoc-Asp(OtBu)-Rink-Amide MBHA Resin is a building block for peptides. It is an acid labile resin that can be cleaved with TFA to provide amine-protected dipeptides and tripeptides. This product is used as a building block for peptide synthesis.
Purezza:Min. 95%H-EFPFYGDYGSNYLYDN^-OH
Peptide H-EFPFYGDYGSNYLYDN^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Ser(tBu)-Wang Resin (100-200 mesh) 1% DVB
Wang resin is a high purity, ion-exchange resin that is used in the preparation of peptides and proteins. The resin contains a cationic quaternary ammonium group that can be used to bind anionic molecules such as phosphates, sulfates, phosphonates, and carboxylates. Wang resin is also capable of binding to the amino groups on proteins. This resin has been shown to have excellent receptor binding capacity for peptides and proteins. In addition, Wang resin has been shown to be an activator of G-protein coupled receptors and ion channels. Wang resin has been used in research for life science and cell biology applications including antibody production and inhibitor studies.Purezza:Min. 95%Fmoc-Thr(tBu)-Rink-Amide MBHA Resin
Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is a resin that can be used for the synthesis of peptides. It is an inhibitor of Protein interactions, Activator, Ligand, and Receptor. This resin can be used in research to study ion channels and antibodies. Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is also a high purity product with CAS No.Purezza:Min. 95%2Adamantyl-RF-NH2
Peptide 2Adamantyl-RF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADHVSFNGYER^-OH
Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSVVYAK^-OH
Peptide H-FSVVYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-YARAAARQARA-OH
Peptide Biot-YARAAARQARA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFGPVDSEQLSR^-OH
Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDRTSASQQSNYGKC-NH2
Peptide H-MDRTSASQQSNYGKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMV pp65 (Human, 495-503)
CMV pp65 (Human, 495-503) is an immunogenic peptide, which is derived from the Human Cytomegalovirus (HCMV) phosphoprotein pp65. Also known as CEF20 or Cytomegalovirus pp65 (495-503), this peptide is a fragment of a viral protein known to play a significant role in the immune response to CMV infection. The source of this peptide is the viral protein itself, specifically a conserved region within it.The mode of action involves its recognition by cytotoxic T lymphocytes (CTLs), which are crucial for evaluating cellular immune responses in research settings. Researchers use it to monitor and study immune responses to HCMV, particularly in contexts involving immunocompromised individuals such as transplant recipients, where CMV infection poses significant risks.In applications, CMV pp65 (495-503) is primarily utilized in immunological studies, including T-cell assays and vaccine research, to better understand the dynamics of immune responses to CMV. Its role in scientific investigations is central to developing therapeutic strategies and diagnostic tools related to CMV and other related viral infections.Formula:C42H74N10O12SPurezza:Min. 95%Peso molecolare:943.18 g/molH-YTHFLTQHYDAKPQGR^-OH
Peptide H-YTHFLTQHYDAKPQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.M CSF Human
M-CSF is a protein that is involved in the regulation of the immune system. It is an activator of macrophages, and it also binds to receptors on cells of the immune system. It can be used as a research tool for studying how cells communicate with each other, and how certain proteins interact with each other. M-CSF is also an antibody that can bind to ion channels and other proteins. This antibody can be used for pharmacological studies to find inhibitors for specific proteins or peptides. M-CSF has been shown to have effects on many different types of cells, including lymphocytes, monocytes, neutrophils, eosinophils, basophils, and mast cells.Purezza:Min. 95%H-Nle-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Nle-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin that is used as a building block for peptide synthesis. It is an alcohol resin that contains amines, thiols, and alcohols. This resin has been shown to be useful in the synthesis of peptides and proteins.Purezza:Min. 95%MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2
CAS:MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.Formula:C55H80N16O16Purezza:Min. 95%Peso molecolare:1,221.35 g/molAc-CDGPTEIYKLTRKEAQE-OH
Peptide Ac-CDGPTEIYKLTRKEAQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIYDGDLK^-OH
Peptide H-GIYDGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β Amyloid 25-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,372.65 g/molH-MATDPENIIK^-OH
Peptide H-MATDPENIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.Purezza:Min. 95%Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y
Peptide Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Pro-Arg-Pro-OH
CAS:Prodotto controllatoH-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).Formula:C18H31N7O5Purezza:Min. 95%Peso molecolare:425.48 g/molLinaclotide
CAS:Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.Formula:C59H79N15O21S6Purezza:Min. 95%Peso molecolare:1,526.76 g/molAc-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIINFEK^L-OH
Peptide H-SIINFEK^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ingap (104-118)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C64H100N20O22Peso molecolare:1,501.6 g/molH-TEQQWNFAGIR^-OH
Peptide H-TEQQWNFAGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FMRF-like neuropeptide flp-9-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H66N12O8Peso molecolare:879 g/molMet-Enkephalin-Arg-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C42H56N10O9SPeso molecolare:877.04 g/molAla-Ile-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C14H27N3O4Peso molecolare:301.38 g/molHXB2 gag #58
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,560.7 g/molAc-YEVHHQKLVF-OH
Peptide Ac-YEVHHQKLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YV^GGQEHFAHLLILR^-OH
Peptide H-YV^GGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Poly-L-Lysine Hydrobromide
CAS:Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers
Purezza:Min. 95%Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide
CAS:Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.
Formula:C28H37N7O7Purezza:Min. 95%Peso molecolare:583.64 g/molH-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-MPIWKFPDEEGAC-NH2
Peptide Ac-MPIWKFPDEEGAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AGCMPYVRIPTA-NH2
Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGPLV^EQGR-OH
Peptide H-LGPLV^EQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
p-Methyl-Benzhydrylamine Resin•HCl (200-400 mesh) 1% DVB
MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.Purezza:Min. 95%CMVpp65 - 66 (QPFMRPHERNGFTVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,829.1 g/molFmoc-D-Pro-OH
CAS:Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.
Formula:C20H19NO4Purezza:Min. 95%Peso molecolare:337.38 g/molH-LGVAGQWR^-OH
Peptide H-LGVAGQWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APAATVVNVDEVR^-OH
Peptide H-APAATVVNVDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGISPLALIK^-OH
Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALREEEEGV^-OH
Peptide H-ALREEEEGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Big Endothelin-1 (Porcine, 1-39)
CAS:This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Formula:C193H289N49O58S5Purezza:Min. 95%Peso molecolare:4,384 g/molElastatinal
CAS:Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and
Formula:C21H36N8O7Purezza:Min. 95%Peso molecolare:512.56 g/molH-KSAPATGGVK^-OH
Peptide H-KSAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIQSLEVIGK^-OH
Peptide H-NIQSLEVIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cathelin-related
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C197H338N56O50Peso molecolare:4,291.1 g/molAc-NNN-NH2
Peptide Ac-NNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRVYI^HPFH-OH
Peptide H-DRVYI^HPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NL^VPMVATV-OH
Peptide H-NL^VPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIASNGVK^LV-OH
Peptide H-FIASNGVK^LV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLHLVL^-OH
Peptide H-ESTLHLVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-YGKDVKDLFDYAQE-OH
Peptide LCBiot-YGKDVKDLFDYAQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pr-LVR^-OH
Peptide Pr-LVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSELPIMHQDWLNGK^-OH
Peptide H-SVSELPIMHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TATSEYQTFFNPR^-OH
Peptide H-TATSEYQTFFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNPVLIGEPGVGK^-OH
Peptide H-NNPVLIGEPGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotinyl-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.Formula:C28H42N6O12SPurezza:Min. 95%Peso molecolare:686.73 g/molHCV NS5B 2588-2596 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-VTSIQD^WV^Q^K^-OH
Peptide H-VTSIQD^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Prodotto controllatoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Formula:C90H120N22O16SPurezza:Min. 95%Peso molecolare:1,798.16 g/molH-SGRGKGGKGLGKGGAK-NH2
Peptide H-SGRGKGGKGLGKGGAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CVSDKIPMTN-OH
Peptide Ac-CVSDKIPMTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-LKIQNRQAAASY-OH
Peptide Biot-LKIQNRQAAASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVCVLK^-OH
Peptide H-AVCVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLAEFATGNDR^-OH
Peptide H-YLAEFATGNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Kisspeptin-13 (4-13) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H83N17O14Peso molecolare:1,302.46 g/molH-LTFPTGR^-OH
Peptide H-LTFPTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 125 (VPMVATVQGQNLKYQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,676 g/molBiot-PEETQTQDQPME-NH2
Peptide Biot-PEETQTQDQPME-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-FTEIPTI^-OH
Peptide Myr-FTEIPTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3766-PI.webp&w=3840&q=75)
