Peptidi
Sottocategorie di "Peptidi"
Trovati 29799 prodotti di "Peptidi"
SARS-CoV-2 ORF1ab (3183-3191)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQAASLEAEHQAIIR^-OH
Peptide H-AQAASLEAEHQAIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,694.1 g/molHXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,800.1 g/molH-SILKV-NH2
Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Ranatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C61H85N16O13SPeso molecolare:1,281.5 g/molH-APGLTQALNTK^-OH
Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQSLQDEVAFLR^-OH
Peptide H-VQSLQDEVAFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLAVDK^-OH
Peptide H-DPLAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LLVP-NH2
Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAAFPEDR^-OH
Peptide H-LAAFPEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-119
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,799.1 g/molβ Amyloid 25-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,372.65 g/molH-GVYYPDK^-OH
Peptide H-GVYYPDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFLVAETPR^-OH
Peptide H-VPFLVAETPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILSPFLP^LL-OH
Peptide H-ILSPFLP^LL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGISPLALIK^-OH
Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KSAPATGGVK^-OH
Peptide H-KSAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIQSLEVIGK^-OH
Peptide H-NIQSLEVIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISLPESLK^-OH
Peptide H-ISLPESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV core protein (128-140)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C66H103N17O17Peso molecolare:1,406.64 g/molH-GVFELSDEK^-OH
Peptide H-GVFELSDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TATSEYQTFFNPR^-OH
Peptide H-TATSEYQTFFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 100 (DDVWTSGSDSDEELV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,653.6 g/molH-QDVDNASLAR^-OH
Peptide H-QDVDNASLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HCV NS5B 2588-2596 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-VTSIQD^WV^Q^K^-OH
Peptide H-VTSIQD^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239-2
Peptide SIVmac239-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C70H123N19O25Peso molecolare:1,630.87 g/molH-AAFDDAIAELDTLSEESYK^-OH
Peptide H-AAFDDAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B2R (54-62)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VGLPINQR^-OH
Peptide H-VGLPINQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mal-VYLKTNVFL-OH
Peptide Mal-VYLKTNVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 125 (VPMVATVQGQNLKYQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,676 g/molLCBiot-SQNPVQP-NH2
Peptide LCBiot-SQNPVQP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MBP (1-11), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C52H88N22O17Peso molecolare:1,293.42 g/molH-K^RPPGFSPF-OH
Peptide H-K^RPPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEVTAYSPLGSSDR^-OH
Peptide H-GLEVTAYSPLGSSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Plasmodium falciparum CSP 334-342 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SLDLDSIIAEVK^-OH
Peptide H-SLDLDSIIAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YSPITNF-NH2
Peptide H-YSPITNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASIR^-OH
Peptide H-FASIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEQEQPLGQWHL^S-OH
Peptide H-NEQEQPLGQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQGFTEDTIVFLPQTDK^-OH
Peptide H-AQGFTEDTIVFLPQTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVLEHVVR^V-OH
Peptide H-KVLEHVVR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGEFSGANK^-OH
Peptide H-VGEFSGANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 75 (TSHEHFGLLCPKSIP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,665.9 g/molCMVpp65 - 74 (DVAFTSHEHFGLLCP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,672.9 g/mol5TAMRA-GQVGRQLAIIGDDINR-NH2
Peptide 5TAMRA-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVIQISNDLENLR^-OH
Peptide H-NVIQISNDLENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WVGYGQDSR^-OH
Peptide H-WVGYGQDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIAEAYLGK^-OH
Peptide H-EIAEAYLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVNEEALR^-OH
Peptide H-FVNEEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YYGYTGAFR^-OH
Peptide H-YYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ADE-OH
Peptide Ac-ADE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myelin Basic Protein (83-99) (bovine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C93H143N25O24Peso molecolare:1,995.31 g/molCMVpp65 - 131 (YRIFAELEGVWQPAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,750 g/molHXB2 gag NO-75/aa297 - 311
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,812 g/molSIVmac239 - 65
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,798.2 g/molH-SFEDIHHYREQIK^-OH
Peptide H-SFEDIHHYREQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDGPVK^V-OH
Peptide H-SDGPVK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSLPSLDPASAK^-OH
Peptide H-SVSLPSLDPASAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQGTFTSDYSK^-OH
Peptide H-HSQGTFTSDYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVTLSLDGGDTAIR^-OH
Peptide H-AVTLSLDGGDTAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSQAVPAVTEGPIPEVLK^-OH
Peptide H-YSQAVPAVTEGPIPEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GEAGPQGPR^-OH
Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHGQDYLVGNK^-OH
Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GTTPSPVPTTSTTSAP-NH2
Peptide Biot-GTTPSPVPTTSTTSAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGEYGFQNAL^-OH
Peptide H-LGEYGFQNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MASMTGGQQMGR^-OH
Peptide H-MASMTGGQQMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALPNNTSSSPQPK^-OH
Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 58 (ESFCEDVPSGKLFMH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,726 g/molH-FSPDDSAGASA^LLR-OH
Peptide H-FSPDDSAGASA^LLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-KKKKEEIYFFF-OH
Peptide Biot-KKKKEEIYFFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SOR-C13
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C72H116N20O19Peso molecolare:1,565.81 g/molAoa-SMFVYGGCQGNNNNFQSKANC-NH2
Peptide Aoa-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 47 (AFVFPTKDVALRHVV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,699 g/molMethyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2
Peptide Methyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEEGDLLVNPDQPR^-OH
Peptide H-AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FTLSVDR-OH
Peptide H-FTLSVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C37H60N10O12Peso molecolare:836.93 g/molMBP MAPK Substrate
Peptide MBP MAPK Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C39H70N18O11Peso molecolare:967.11 g/molH-QGDVFVVPR^-OH
Peptide H-QGDVFVVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-2Kd Mouse MAGE-A3 SYVKVLHHM
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H79N11O11S1Peso molecolare:958.22 g/molHXB2 gag NO-21/aa81 - 95
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,774.1 g/molAc-SNKDRHIDSSC-NH2
Peptide Ac-SNKDRHIDSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-WSLGYTG-OH
Peptide LCBiot-WSLGYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 6 (HVLKAVFSRGDTPVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,638.9 g/molH-GPSSVEDIK^-OH
Peptide H-GPSSVEDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 73 (HIMLDVAFTSHEHFG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,741 g/mol5TAMRA-RRRRRRRRRC-NH2
Peptide 5TAMRA-RRRRRRRRRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MKNPKKKSGGFRIVC-NH2
Peptide H-MKNPKKKSGGFRIVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-FSFKGIKFSKGKYK-NH2
Peptide Ac-FSFKGIKFSKGKYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AMRNALVRF-NH2
Peptide H-AMRNALVRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PACAP-27 (human, mouse, ovine, porcine, rat)
CAS:PACAP 1-27 (Pituitary adenylate cyclase-activating polypeptide 27) is a potent stimulator of adenylyl cyclase and increases cAMP levels.Formula:C142H224N40O39SPeso molecolare:3,147.65 g/molHCV NS4A 1635-1643 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-AL^PAPIEK-OH
Peptide H-AL^PAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDSILAVR^-OH
Peptide H-EDSILAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKNTPDPDDLFSDI-OH
Peptide Ac-CKNTPDPDDLFSDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPVITGAPYEYR^-OH
Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 91
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,582.9 g/molH-GAVGVGK^SA-OH
Peptide H-GAVGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DQLIVNLLK^-OH
Peptide H-DQLIVNLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DLIEEAASRPVDAVPEQVKAAGAY-NH2
Peptide Ac-DLIEEAASRPVDAVPEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-89/aa353 - 367
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,492.8 g/molH-LPPYLFT-OMe
Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGYMHWYQQKPGK^-OH
Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVNELIYK^-OH
Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:937.05 g/molFmoc-Cys-OH
Peptide Fmoc-Cys-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNLLSAIK^-OH
Peptide H-VNLLSAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Kisspeptin 234
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C63H78N18O13Peso molecolare:1,295.42 g/molH-LTVEDPVTVEYITR^-OH
Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EILDAFDK^-OH
Peptide H-EILDAFDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PLP (139-151)
CAS:PLP (139-151) peptide is a fragment of myelin proteolipid protein (PLP or lipophilin), from amino acid residue 139 to 151 (HCLGKWLGHPDKF – CAS 131334-43-5 ). Myelin proteolipid protein is the major myelin protein from the central nervous system. PLP (139-151) peptide is commonly used to induce experimental autoimmune encephalomyelitis (EAE) in SJL/J mice. The PLP (139-151) peptide C140S is mutant of the wild-type version where the cystein is replaced by a serine to make the peptide more stable without impacting its antigenic activity.Formula:C72H104N20O17Peso molecolare:1,521.7 g/molSurvivin 93-101 mutant (HLA-A*01:01) 94T
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-STSGGTAALGCLVK^-OH
Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VVVVVVD-OH
Peptide Ac-VVVVVVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GK^GDPK^K^PR-OH
Peptide H-GK^GDPK^K^PR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dynorphin B
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C74H115N21O17Peso molecolare:1,570.8 g/molH-LSVEALNSLTGEFK^-OH
Peptide H-LSVEALNSLTGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Atrial Natriuretic Factor (1-28)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C127H203N45O39S3Peso molecolare:3,080.46 g/molSIVmac239 - 60
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,715.9 g/molH-DPEGVPPLLVSQQAK^-OH
Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNFYAWK^-OH
Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-GAGSLQPLALEGSLQKRG-OH
Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLAEVATGEK^-OH
Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELHHLQEQNVSNA^FLDK^-OH
Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DDTSRMEEVD-OH
Peptide Ac-DDTSRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-APEEIMRRQ-EDDnp
Peptide Abz-APEEIMRRQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^IFDANAPVAVR^-OH
Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 53 (ENTRATKMQVIGDQY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,754 g/molAla-Asp-Ser-Asp-Pro-Arg
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C25H41N9O12Peso molecolare:659.65 g/molPLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SPeso molecolare:1,583.8 g/molH-SSDTEENVK^-OH
Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARV^YIHPF-OH
Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GEGQQHHLGGAKQAGDV-OH
Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DREQAPNL^VY-OH
Peptide H-DREQAPNL^VY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIQLVEEELDR^-OH
Peptide H-GIQLVEEELDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARTKQTARKSTGGKAPRKQLA-NH2
Peptide H-ARTKQTARKSTGGKAPRKQLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-56/aa221 - 235
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,567.8 g/molAc-DPKSAAQNSKPRLSFSTKC-NH2
Peptide Ac-DPKSAAQNSKPRLSFSTKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molNeuregulin 4 (Nrg4) / pro-Neuregulin 4 (1-61) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:6,656.63 g/molH-ILSP^FLPLL^-OH
Peptide H-ILSP^FLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neurogranin (43-75) (Human, Monkey)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,984.34 g/molLCBiot-NLRKSGTLGHPGSL-OH
Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C194H297N55O56SPeso molecolare:4,327.9 g/molCMVpp65 - 16 (YTPDSTPCHRGDNQL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molCMVpp65 - 76 (HFGLLCPKSIPGLSI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,582 g/molNangibotide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C54H82N14O22S2Peso molecolare:1,343.44 g/molFmoc-GRGDSPK-OH
Peptide Fmoc-GRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-VAAWTLKAAA-NH2
Peptide Ac-VAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASNTAEVFFDGVR^-OH
Peptide H-ASNTAEVFFDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLQGLPR^-OH
Peptide H-VLQGLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDGPVKV^-OH
Peptide H-SDGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Apolipoprotein C-III [25-40]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-R^PPGFSP-OH
Peptide H-R^PPGFSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SANILLDEAF^TAK-OH
Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,765.1 g/molAc-PGP-OH
Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILDFGLAR^-OH
Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-GIGTIISSPYR-OH
Peptide H2N-GIGTIISSPYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK^-OH
Peptide H-IPNAGQMQPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-YAPP-OH
Peptide LCBiot-YAPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGTDDHTLIR^-OH
Peptide H-GAGTDDHTLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSEIQLMHNLGK^HLNSMERVEWLRKKLQDVHN-OH
H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-LFDNAMLR^-OH
Peptide H-LFDNAMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVMEYLPSGCLR^-OH
Peptide H-LVMEYLPSGCLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFDQIDNAPEEK^-OH
Peptide H-AFDQIDNAPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVY^FCHLDIIW^-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C109H163N25O32S5Peso molecolare:2,495.97 g/molH-AASLDGFYNGR^-OH
Peptide H-AASLDGFYNGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RFGRFLRKILRFLKK-NH2
Peptide Ac-RFGRFLRKILRFLKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Defensin-1 (human) HNP-1
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C150H222N44O38S6Peso molecolare:3,442.1 g/molFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,906.3 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SPeso molecolare:4,449.9 g/molH-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-LYENKPRRPYIL
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C73H116N20O18Peso molecolare:1,561.84 g/molH-LSVPTSEWQR^-OH
Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Apolipoprotein C-III [25-40]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP51036.webp&w=3840&q=75)
