Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 29801 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
[Cy3B]-LifeAct (Abp140 1-17)
[Cy3B]-LifeAct (Abp140 1-17) contains the 17amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. On application, lifeact can be used in the study of plant development and pathogen defence as filamentous actin within the plant actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements.The addition of the Cy-Dye fluorophore, Cy3B allows the location of the LifeAct (Abp140 1-17) to be detected. Cy3B is described as being conformationally locked meaning it is less likely to undergo photo-isomerization and one of its main applications is within DNA related studies.Colore e forma:PowderPeso molecolare:2,465.2 g/molCMV IE-1 (213-225)
CMV pp65 (415-429) (HLA-B7) is a CEF (cytomegalovirus, Epstein-Barr virus, and influenza virus) control peptide that is derived from the Cytomegalovirus (CMV). CMV is capable of infecting a wide range of human cell types, where the body's primary immune response to CMV is innate, and relies on inflammatory cytokines and costimulatory molecules in order to control the spread of the virus. CMV pp65 (415-429) (HLA-B7) is defined as a CEF control peptide due to its antigenic properties. Clinically, these peptides are suitable epitopes for CD8+ T cells and can be used to stimulate the release of IFNg. HLA-B7 refers to the cell HLA type that this peptide acts on.Peso molecolare:1,516.8 g/molH-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Temporin L
Temporin L is a highly potent anti-microbial peptide (AMP) active against both Gram-positive and Gram-negative bacteria. Temporins are a large family of short, linear, AMPs produced in the skin of frogs belonging to Rana species, but are also found in wasp venom. Temporin L was originally isolated from the frog Rana temporaria and has the highest anti-microbial potency among tested temporins, especially against Gram-negative bacteria.Temporin L increases bacterial inner membrane permeability in a dose-dependent manner without destroying cell integrity. At low peptide concentrations, the inner membrane becomes permeable to small molecules but this does not kill the bacteria. At high concentrations, larger molecules, but not DNA, leak out, resulting in cell death. Temporin L has a different mode of action to many AMPs as it does not lyse the cells but instead forms ghost-like bacteria shells.Colore e forma:PowderPeso molecolare:1,639 g/molH-ARTKQTARKSTGGKA-NH2
Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5-FAM-Fz7-21
Fz7-21 is a potent and selective peptide antagonist of Frizzled 7 (FZD 7) receptor which selectively binds to FZD7 cysteine rich domain (CRD) subclass at the cysteine rich region proximal to the lipid-binding groove. Binding alters the conformation of the CRD and the architecture of its lipid-binding groove and impairs Wnt/β-catenin signalling. Peptide Fz7-21 also shows cross-species binding to both the human and mouse FZD7 CRD.The FZD7 receptor is enriched in intestinal stem cells which express the LGR5 receptor and plays a critical role in the cells self-renewal. FZD7 is essential for maintaining human embryonic stem cells in their undifferentiated state and is therefore an attractive pharmacological target for diseases associated with stem cell dysfunction and cancer biology.FZD7 is also upregulated in subsets of colon, pancreatic and gastric tumours, therefore Fz7-21 serves as a pharmacological probe to explore further the function of FZD7 in stem cell and cancer biology.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
Peso molecolare:2,110.8 g/molC-terminal Sortagging-[Cys(AF680)] amide
This C-terminal Sortagging peptide acts as an (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Cys(AF680)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye. This method of protein labelling is known as sortagging.C-Terminal Sortagging-[Cys(AF680)] peptide contains the AF680 fluorescent dye- AF680 is a bright green dye with excitation at 633 nm, well suited for flow cytometry and imagery. AF680 is particularly photostable, allowing better detection of low abundance conjugates. C-Terminal Sortagging-[Cys(AF680)] amide is provided here. However, the acid version is also available in our catalogue.Peso molecolare:1,240.3 g/molAc-DDTSRMEEVD-OH
Peptide Ac-DDTSRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-APEEIMRRQ-EDDnp
Peptide Abz-APEEIMRRQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^IFDANAPVAVR^-OH
Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.sgp91 ds-tat Peptide 2, scrambled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C98H190N50O22SPeso molecolare:2,453 g/molH-VQIVYKPVDLSK^-OH
Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVEAFGGATK^-OH
Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQNDTSQTSSPS-Phosphocolamine
Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ara h 2 (147-155) peanut Allergen
Ara h 2 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 2 is a member of the 2S albumins (conglutinins) belonging to the prolamin superfamily which also includes Ara h 6. 2S albumins contain major food allergens from seeds of many mono- and dicotyledon plants and share a common compact structure that renders the proteins highly resistant to proteolysis.In mouse models Ara h 2 and Ara h 6 are the main cause of effector responses such as mast cell degranulation and anaphylaxis. Ara h 2 has a high predictive value for diagnosis of clinical peanut allergy and is also more potent than Ara h 1 or Ara h 3 in histamine release assays and skin prick tests.This peptide represents a tryptic peptide of Ara h 2.Colore e forma:PowderPeso molecolare:1,027.5 g/molSIVmac239 - 53
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molPLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SPeso molecolare:1,583.8 g/molHistone H4 (1-23)
Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are fundamental in compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4's lysine rich tail plays a role in the higher order chromatin folding.Colore e forma:PowderPeso molecolare:2,400.5 g/molH-R^FF-OH
Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV p17 Gag (77-85)
The HIV gag gene encodes p17 and p24. P17 Gag is a matrix protein that is vital to HIV life cycle, it targets viral RNA to the nucleus and Gag polyproteins to the cell membrane- p17 Gag accumulates in the extracellular space of tissue while interacting with receptors on various cell types to deregulate cell function.During HIV infection the cytotoxic T lymphocyte (CTL) response is key to attenuating viral replication. CTL recognition epitope of p17 Gag is identified as residues 77-85 to activate the immune response. HIV p17 Gag CTL epitope has been used in IgG titres and has been suggested as a suitable prognostic tool for onset of AIDS. A high affinity of IgG for p17 Gag was correlated to patients remaining in an asymptomatic state. p17 Gag epitope has been shown to induce a strong CTL response in the majority of chronically infected HIV patients. This makes the p17 Gag epitope a target for molecular therapy for HIV treatment and potentially a vaccine development.Colore e forma:PowderPeso molecolare:980.5 g/molAc-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Albumin (mouse, rat)
Albumin is a family of globular, water soluble, un-glycosylated proteins commonly found in blood plasma. Albumins generally act as transport proteins that bind to various ligands to transport them around.The most common member of this family is serum albumin. Serum albumin is produced by the liver and is the most abundant plasma protein, it provides oncotic pressure, transports bilirubin, steroids, fatty acids, thyroid hormones and other hormones, and serves as an extracellular antioxidant agent.Too much or too little circulating serum albumin may be harmful. Perturbations in serum albumin concentration is associated with both type 2 diabetes and metabolic syndrome (MetS). Increase in serum albumin concentration might protect against early glycemic deterioration and progression to type 2 diabetes even in subjects without MetS. Albumin in the urine usually denotes the presence of kidney disease.Peso molecolare:1,055.7 g/molH-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALPQYLK^-OH
Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C49H74N10O11Peso molecolare:979.18 g/molH-PQNLLLDPDTAVLK^-OH
Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISIDVNNNDIK^-OH
Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Urumin
Urumin is a veridical host defence peptide against influenza A virus.The peptide specifically targets the evolutionarily conserved H1 hemagglutinin stalk region of H1-containing influenza A viruses.Urumin has been used against drug-resistant influenza A viruses that are resistant against oseltamivir, zanamivir and peramivir. While its mechanism of action is not fully understood, urumin seems to inhibit viral growth by physically destroying influenza A virions, and is able to protect naive mice from doses of influenza A infection as high as 2 times the LD50. Because of its specific targeting of the hemagglutinin stalk region of the influenza A virus, the mechanism of action of urumin is similar to that of antibodies induced in the body by universal influenza vaccines.Peso molecolare:2,959.4 g/molHLA-A*02:01 HBV core (18-27)
HLA-A*02 is a class I major histocompatibility complex (MHC) allele which is part of the HLA-A group of human major histocompatibility complex (MHC) leukocyte antigens (HLA). HLA-A is a human MHC class I cell surface receptor and is involved in presenting short polypeptides to the immune system. These polypeptides are typically 7-11 amino acids in length and originate from proteins being expressed by the cell. Cytotoxic T cells in the blood "read" the peptide presented by the complex and should only bind to non-self peptides. If binding occurs, a series of events is initiated culminating in cell death via apoptosis. This peptide corresponds to the Hepatitis B variant (HBV) core sequence which is presented on the MHC class I antigen HLA-A*02.Peso molecolare:1,154.6 g/molH2NCO-HAEGTFTSDVSSYLEGQ-NH2
Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGSEAYNQQLSEK^-OH
Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QQRFEWEFEQQ-NH2
Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C72H98O22N20Peso molecolare:1,595.7 g/molh-Chemerin-9 (149-157)
A Chemerin-9 peptide derived from chemerin, a protein that is involved in a variety of functions such as autocrine, angiogenic, reproductive and chemotactic processes. Chemerin-9 binds to the chemerin receptor 23 (G-protein coupled receptor) and causes the receptors internalisation.Peso molecolare:1,063.5 g/molH-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SETD8 Peptide
Setd8 is a member of the SET domain containing family of proteins and is the sole methyltransferase that catalyses monomethylation of lysine 20 on histone H4 (H4K20me1). This histone modification is involved in regulating DNA replication, chromosome condensation and gene expression.Setd8 is widely expressed and in addition to modifying histone H4, it can modify non-histone proteins, including p53. Setd8 has been shown to play a role in maintaining skin differentiation and is dysregulated in multiple cancer types.Peso molecolare:1,076.7 g/molCbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Acetyl-Histone H4 (1-21)
Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are essential for compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4 lysine rich tail plays a role in the higher order chromatin folding.Acetyl-Histone H4 (1-21)-has an uncharged C-terminal amide and is protected from N-terminal modifications by a covalently bonded acetyl group.Peso molecolare:2,131.3 g/molAc-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C73H116N20O18Peso molecolare:1,561.84 g/molH-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-4 Agonist (Mouse)
CAS:Thrombin is the main effector of the coagulation cascade- it is a serine protease. Thrombin binds to active protease activated receptor (PAR) which belongs to a subfamily of G-protein coupled receptors (GPCR). Thrombin activation of mouse PAR-4 reveals an amino terminus sequence of GYPGKF. This is the natural ligand for PAR-4. GYPGKF binds internally to the receptor and leads to signalling activation. Identification of GYPGKF as a PAR-4 agonist has allowed better understand of the function of PAR. Addition of GYPGKF to PAR-4 expressing cell lines achieved 55% of the maximal response of thrombin. GYPGKF can provide understanding of PAR-4 and a template for more potent agonists.
Formula:C33H46N8O7Colore e forma:PowderPeso molecolare:666.3 g/molSpexin
Spexin is a neuropeptide that is conserved amongst humans and rodents. Spexin activates galanin2/3 receptors, inducing a different active conformation of GalR2 to galanin. The broad distribution of spexin suggests multiple physiological roles including as a regulating factor in obesity and energy metabolism. Spexin is ubiquitously expressed in human tissue, however, a correlation has been found with obesity and age. Obese patients had significantly lower levels of circulating spexin than those with a healthy weight range. The significance of this suggests spexin regulates appetite, feeding behaviour, and energy expenditure. Spexin also specifically inhibits the uptake of long-chain fatty acids by adipocytes.Spexin is a central modulator of cardiovascular and renal function and can elicit central nervous system behavioural responses. As spexin levels decrease with age there is research to understand if it plays a role in age-related pathophysiology of cardiometabolic conditions. Spexin is also being considered an early biomarker for cardiovascular disease due to the magnitude with which it decreases as the pathophysiology progresses.Peso molecolare:1,618.8 g/molH-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fibrinopeptide
Fibrinogen is a large plasma glycoprotein with a complex structure, and one of the most abundant proteins in blood. Fibrinogen is important in fibrin clot formation, haemostasis, and inflammatory responses. Increased plasma fibrinogen indicates a proinflammatory state and is a risk factor for vascular inflammatory diseases including hypertension and atherosclerosis. Fibrinogen cleavage products act as inflammatory activators in the pathophysiology of allergic asthma.The conversion of monomeric fibrinogen into polymeric fibrin is mediated by thrombin, which binds to fibrinogen and catalyses cleavage of fibrinopeptide A (FpA) and fibrinopeptide B (FpB). Fibrinopeptide B is protected from modifications such as carbamylation by pyroglutamination of the N-terminal amino acid.Colore e forma:PowderPeso molecolare:1,551.7 g/molSakamototide
Sakamototide is phosphorylated by members of the 5'-adenosine monophosphate-activated protein kinase (AMPK) family of kinases as is therefore ideal for use in kinase assays to test the activity of AMPK family members. The AMPK family includes- salt inducible kinases (SIKs), NUAK's, sucrose non-fermenting (Snf1)-related kinase (SNRK), microtubule affinity regulating kinases (MARKs) and brain specific kinase/BR serine/threonine kinase (BRSK). The kinase activity of AMPK and AMPK-related kinases, is dependent on its phosphorylation at Thr175 by the upstream kinase LKB1 (also known as STK11).Colore e forma:PowderPeso molecolare:1,738.9 g/molExendin 4 (4-39)
This is a truncated exendin-4 peptide, the original peptide was identified in Gila monster lizard (Heloderma suspectum). Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.Colore e forma:PowderPeso molecolare:3,860.9 g/molAoa-DYKDDDDK-OH
Peptide Aoa-DYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDIER^-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EVGDWRK^-OH
Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPVSDR^-OH
Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRAELEKHGYKMETS
Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool[FITC]-Ahx-(KKEEE)3K carrier peptide
The [FITC]-Ahx-(KKEEE)3K carrier peptide contains the fluorescent label fluorescein isothiocyanate (FITC), where the isothiocyanate can generate a stable thiourea linkage through reacting with the amine group present on protein molecules. The Ahx group (1,6-aminohexanoic acid) is used as a spacer to N-terminally link the FITC to the (KKEEE)3K carrier peptide. The (KKEEE)3K peptide sequence has shown significant specific renal targeting, thus giving it kidney-specific drug carrier properties. In particular its ability to target drugs to the proximal tubule cells of the kidney suggests potential to aid in the treatment of renal diseases.
Peso molecolare:2,578.83 g/molMelanocyte Protein PMEL 17 (44-59) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C95H137N27O28Peso molecolare:2,105.3 g/molHXB2 gag NO-83/aa329 - 343
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,514.9 g/molH-ANELLINVK^-OH
Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GNPESSFNDENLR^-OH
Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLESSLR^QA-OH
Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Histone H3 (20-39)-Biotin
Histone H3 (20-39)-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.
Colore e forma:PowderPeso molecolare:2,256.3 g/molH-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C275H477N125O51Peso molecolare:6,350.54 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYIHP^F-OH
Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSVFPLAPSSR^-OH
Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR^-OH
Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTVDTTLAGYHLPK^-OH
Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TENNDHINLK^-OH
Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPEQTQGNFGDQELIR^-OH
Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK^-OH
Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MP196
MP196, a RW-rich peptide, displays antibacterial properties through preventing bacterial cell wall synthesis and cellular respiration. Due to it lacking hemolytic and cytotoxic qualities, MP196 can be used to synthesis antibiotics and aid in the global problem of antibiotic resistance.Colore e forma:PowderPeso molecolare:1,043.6 g/molAc-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin U 25
Neuromedin U (NmU) is a neuropeptide expressed in various organs including the brain, gut, bone marrow and lungs. NmU has a wide range of roles in physiology including: decreasing appetite and body weight and increasing gross locomotor activity, heat production, oxygen consumption, uterine smooth muscle contraction, body temperature, and bone mass. It is also involved in regulating circadian rhythm, stress response and blood flow and ion transport in the gut. NmU can also stimulate cytokine production and promote mast cell-mediated inflammation and is important during the early proliferative stages of erythroid development. NmU has been shown to be a c-Myb target gene and NmU in turn activates protein kinase C-βII, a factor associated with hematopoietic differentiation-proliferation.Two related G protein-coupled receptors have been identified as NmU receptors: NMU-R1: expressed in various tissues, including the small intestine and lung, and NMU-R2: predominantly expressed in the hypothalamus and the small intestine. Activation of these receptors via NmU binding mobilises intracellular Ca2+ stores and downstream signalling.Peso molecolare:3,078.5 g/molH-SEVAHR^-OH
Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVDLSTFYQNR^-OH
Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Macropin 1
Macropin-1 (MAC-1) is an anti-microbial peptide (AMP) isolated from venom of the solitary bee Macropis fulvipes (Hymenoptera: Melittidae). MAC-1 has activity against both Gram-positive and Gram-negative bacteria, including drug-resistant strains. MAC-1 can inhibit biofilm formation in Staphylococcus aureus and Pseudomonas aeruginosa and also exhibits anti-fungal activity. MAC-1 has little to no haemolytic activity against human cells at microbiologically effective concentrations.Macropin acts by first binding to negatively charged bacterial membrane components- such as peptidoglycan (PTG) or lipopolysaccharide (LPS). Macropin then kills the bacteria by disrupting the outer bacterial membrane and depolarising the cytoplasmic membrane to cause cell penetration.Peso molecolare:1,416.86 g/molMBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,645.1 g/molH-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQVLVFLGQSEGLR^-OH
Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK^-OH
Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLELTSDNDR^-OH
Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL^-OH
Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVGAVLK^-OH
Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPDATPK^-OH
Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Histone H3 (1-20)-GG-[Cys(AZ647)]
Histone H3 (1 - 20) is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation. The purpose of the modifications is believed to alter chromatin function/structure. Histone H3 (1 - 20), with no modifications, is a valuable peptide in the study of epigenetics. It can aid in understanding interaction with histone effectors and the histone tail using crystallisation and pull-down assays on affinity matrices. Histone H3 (1 - 20) is labelled with the Aurora Fluor 647 fluorescent tag.Peso molecolare:3,378.6 g/molAngiotensin II, ala(8)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C44H67N13O12Peso molecolare:970.1 g/molPAR-3 Agonist (Human)
Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-3 agonist peptide represents the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.PAR-3 is required for intercellular adhesion molecule 1 (ICAM-1) expression in endothelial cells and PAR-3 cooperates with PAR-1 to mediate the effect of thrombin on cytokine production and vascular cell adhesion molecule (VCAM- 1) expression.Peso molecolare:646.4 g/mol[5-FAM]-Tyr-Ahx-Ser-Asp-Lys-Pro-acid
[5-FAM]-Tyr-Ahx-SDKP-acid
Colore e forma:PowderPeso molecolare:1,079.4 g/molH-CGKGLSATVTGGQK^GRGSR-OH
Peptide H-CGKGLSATVTGGQK^GRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAVVR^-OH
Peptide H-VAVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RLR-[Rh110]-[D-Pro]
Fluorogenic substrate peptide to assay trypsin-like activity. In its intact state this peptide is non-fluorescent, however when the Rhodamine fluorophore is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing trypsin-like enzyme activity.The presence of the D-proline residue on the C terminal of the rhodamine molecule ensures one directional rhodamine cleavage which simplifies fluorescence studies. Rhodamine 110 is a laser grade fluorescent dye with excitation maxima at 496 nm and emission maxima at 522 nm.Peso molecolare:894.5 g/molAc-ASQETFG-NHMe
Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.OVA (250-264)
Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (250-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.Peso molecolare:1,718.9 g/molSIVmac239 - 98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,657.9 g/molInsulysin FRET substrate [Mca]/[Dnp]
The Insulysin FRET substrate [Mca]/[Dnp] is a synthetic insulysin peptide substrate that contains an N-terminal fluorescent 7-methoxycoumarin (Mca) group and a C-terminal 2, 4-dinitrophenyl (Dnp) quencher. This FRET peptide exhibits internal fluorescence quenching when intact, however hydrolysis of the peptide between the donor/acceptor pair generates fluorescence, enabling the quantitative measure of enzymatic activity.Insulysin, also known as insulin-degrading enzyme (IDE), is a highly conserved zinc metallopeptidase that contains an inverted zincin motif (HXXEH), characteristic of the inverzincin family of proteases. Insulysin functions as a dimer and exhibits allosteric kinetics, whereby small substrate peptides and polyphosphates such as ATP can act as enzyme activators. The endopeptidase cleaves a wide variety of substrates that are diverse in length, structure and sequence and exhibits a preference for basic or bulky hydrophobic residues.Insulysin is ubiquitously expressed and is responsible for insulin catabolism and the degradation of many bioactive peptide substrates including glucagon, TGF-alpha, β-endorphin, dynorphins and atrial natriuretic peptide. Insulysin also selectively degrades amylin and β-amyloid amyloidogenic peptides at multiple sites.Fluorescence Resonance Energy Transfer (FRET) peptides are convenient tools for the study of peptidase specificity and enzymatic activity.Peso molecolare:1,422.6 g/molCMVpp65 - 67 (RPHERNGFTVLCPKN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,768 g/molHuman/Rat/Mouse PLP40-59 peptide, depalmitoylated
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolGLK-19
Anti-microbial peptide (AMP) designed using only residues G, L, and K (GLK-19). Active against-Escherichia coli-with higher activity relative to human AMP LL-37 and also weakly active against methicillin-resistant Staphylococcus aureus (MRSA), but not-active against HIV-1. Activity against E. coli with a minimal inhibitory concentration (MIC) at 10 mM.Colore e forma:PowderPeso molecolare:2,104 g/molAlloferon 2
Alloferon 2, a member of the Alloferons was extracted from the blood of a Callifora vicina fly who had been experimentally infected. The Alloferons are, bioactive, cationic peptides and can stimulate Natural Killer cell activity and IFN synthesis.Peso molecolare:1,127.5 g/molpp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
Cytomegalovirus (CMV) is a prevalent human pathogen of concern in the immunocompromised such as during organ transplant or in AIDs patients- it can potentially be fatal. Due to the commonness of CMV, one strategy being developed is prevention of viral reactivation in immunosuppressed groups. Current antivirals have significant toxicity thus pushing the search for a specific CMV therapy.Murine CMV has been well established as a model for human CMV, including its susceptibility to T cell mediated clearance. The immediate-early protein 1 (IE1) was fragmented and used to find the best IE1 epitope as a vaccine. YPHFMPTNL, provided here, recognized by H-2 Ld-restricted CD8+ T cells was the best epitope of IE1 for T cell recognition. The fragment has been used to successfully generate CD8+ T cell clones specific for the IE1 epitope of murine CMV. This peptide has the potential to further the development of antiviral immunotherapy for CMV and better understand its ability to evade the host immunity.Peso molecolare:1,118.5 g/molFeleucin-B01
Feleucin-B01 was recently identified from the skin secretion of the toad Bombina orientalis with a role in preventing the host from bacterial infection. Synthetic feleucin-B01 shows limited antimicrobial activity against a reference Gram-positive bacterium and is ineffective against the Gram-negative and yeast strains. The mode of action of the non-apeptide is lysis of the bacterial membrane resulting in rapid bacterial death. Feleucin-B01 shows a limited role in the secreted host defences which is complemented by the range of alternate antimicrobial peptides (AMP) also excreted. The amphipathic feleucin-B01 sequence is being studied as a template to hopefully generate more potent synthetic versions with a broader range of activity.Peso molecolare:931.17 g/molH-L^SQLQTYMI^-OH
Peptide H-L^SQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Semaglutide Heavy
Semaglutide is a glucagon-like peptide-1 receptor agonist (GLP-1 RA). It mimics the GLP-1 hormone, released in the gut in response to eating. Semaglutide can enhance insulin secretion and suppress glucagon section in a glucose-dependent manner. It also increases gastric emptying time and reduces intestinal motility. This combination leads to a decrease in appetite. Semaglutide has a long half-life allowing weekly subcutaneous application. Semaglutide also has positive effects on heart, liver, and lung function. Semalgutide also slows the progression of the effects of Alzheimer’s disease. This is a heavy isotype-labelled version of semaglutide that is suited to peptide quantification by mass spectrometry. This allows it to be used as an internal standard for quantification of semaglutide. There are two phenylalanine residues isotopically labelled with carbon-13 (9) and nitrogen-15 (1); one valine is labelled with carbon-13 (5) and nitrogen-15 (1); two leucine residues labelled with carbon-13 (6) and nitrogen-15 (1). This semaglutide peptide has a mass increase of 40 compared to the unlabelled peptide.25nmol = 0.1mgFormula:C35C152H291N5N40O59Colore e forma:PowderPeso molecolare:4,151.2 g/molH-STAGNFLVNPLEPK^-OH
Peptide H-STAGNFLVNPLEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGGPQGPR^-OH
Peptide H-GEGGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PKKKRKVEDPYC-NH2
Peptide Ac-PKKKRKVEDPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGDIVPLGVTHMTSR^-OH
Peptide H-FGDIVPLGVTHMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leucyl-Phenylalanyl-Isoleucyl-Glutamyl-Tryptophyl-Leucyl-Lysine Trifluoroacetate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C49H73N9O10Peso molecolare:948.17 g/molSteroid Receptor Coactivator-1, SRC-1 (686-700)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C77H131N27O21Peso molecolare:1,771.2 g/molHLA leader peptide LIL
Peptide H-VMAPRTLIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-79/aa313 - 327
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,761 g/molH-TEAFIPFSLGK^-OH
Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GRADSP-NH2
Peptide Biot-GRADSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNVWDTAGQEK^-OH
Peptide H-FNVWDTAGQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FGF 2 Mouse
FGF-2 is a protein that belongs to the FGF family. It is an activator of erythropoietin, which stimulates the production of red blood cells. FGF-2 also acts as a ligand for FGFR1 and FGFR2, which are receptors for FGF-2. The binding of FGF-2 to these receptors leads to a cascade of cellular responses by activating different types of ion channels and proteins involved in cell proliferation and differentiation. This protein is purified from mouse sources with high purity and no detectable endotoxin levels.Purezza:Min. 95%H-YNGIITETIK^-OH
Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Phe-Rink-Amide MBHA Resin
Fmoc-Phe-Rink-Amide MBHA Resin is a peptide resin that has been used as an inhibitor of protein interactions and as a research tool in the study of ion channels. It is a high purity resin that is free of any ligands, activators, or receptors. This product can be used to purify antibodies and other proteins. Fmoc-Phe-Rink-Amide MBHA Resin is also used as an activator of Protein A affinity chromatography and for the purification of antibodies and other proteins.Purezza:Min. 95%Cyclorasin 12A
Cyclorasin 12A is a research tool that can be used to activate or block ligands on their receptors. Cyclorasin 12A is a peptide fragment of cyclosporin A, which is an immunosuppressive agent. Cyclorasin 12A binds to the receptor, which activates the ion channels and inhibits the activity of protein kinases. Cyclorasin 12A has been shown to inhibit ion channels in cells and also has been found to reduce inflammation by inhibiting cytokine production.Formula:C71H102N27O11FPurezza:Min. 95%Peso molecolare:1,528.78 g/molH-AAAHVVEGAAGYAGHK^-OH
Peptide H-AAAHVVEGAAGYAGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQL^G-OH
Peptide H-DMQL^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LRRQHAR^ASHLGLAR-OH
Peptide H-LRRQHAR^ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AR^PALEDLR-OH
Peptide H-AR^PALEDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVY^DGR^EHTV-OH
Peptide H-GVY^DGR^EHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CSYWKPRYLGAKRF-OH
Peptide Ac-CSYWKPRYLGAKRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QKDGNDFKFNYQGDEC-NH2
Peptide Ac-QKDGNDFKFNYQGDEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-Leu-pNA (Hydrochloride Form)
Met-Leu-pNA (Hydrochloride Form) is a peptide that binds with high affinity to the N-methyl-D-aspartate receptor, an ion channel protein. It is used in research tools and as an inhibitor. The peptide has been shown to inhibit the activity of the receptor by competitive inhibition, preventing binding of glutamate, which normally activates the ion channel. This inhibition leads to a decrease in neuronal excitability and decreased production of proinflammatory cytokines.Formula:C17H26N4O4S•HClPurezza:Min. 95%Peso molecolare:418.95 g/molMelanocyte Associated Antigen gp100
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H68N12O13Peso molecolare:961.09 g/mol[Nle4, D-Phe7]-ß-MSH-Amide
Melanocyte Stimulating Hormone (MSH) and Related Peptides are a group of peptides that have a role in the regulation of skin pigmentation. One such peptide is Nle4, D-Phe7]-ß-MSH-amide, which is an agonist of melanocortin receptors. It has been shown to stimulate the proliferation and cause the differentiation of melanocytes in vitro, as well as to increase the number of melanocytes in vivo.Formula:C78H111N21O19Purezza:Min. 95%Peso molecolare:1,646.88 g/molH-SV^^LGQL^GITK^-OH
Peptide H-SV^^LGQL^GITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKYDLSIRGFNKETA-NH2
Peptide Ac-CKYDLSIRGFNKETA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GGRGGFGGRGGFGGRGGFG-NH2
Peptide Biot-GGRGGFGGRGGFGGRGGFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFESLK^-OH
Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNTL^TER-OH
Peptide H-VNTL^TER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFLRRQFK^VVT-OH
Peptide H-YGGFLRRQFK^VVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Experimental Allergic Encephalitogenic Peptide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C46H64N14O14Peso molecolare:1,037.11 g/molDnp-Gly-Pro-Leu-Gly-Met-Arg-Gly-Leu-NH2
This peptide is a collagenase, MMP-13 and stromelysin substrate. It can be used as a biochemical in enzyme assays to measure the activity of collagenases and MMPs.
Formula:C40H64N14O12SPurezza:Min. 95%Peso molecolare:965.11 g/molAc-Pro-Arg-Asn-Lys-Acc-NH2
Ac-Pro-Arg-Asn-Lys-Acc-NH2 is a peptide that is used to study the catalytic mechanism of enzymes. It has been shown to be an effective substrate for tryptase, which is an enzyme that plays a role in the degradation of proteins. Ac-Pro-Arg-Asn-Lys-Acc-NH2 binds to the active site of tryptase and undergoes a series of reactions that lead to its hydrolysis. The rate constants for these reactions have been measured in order to determine kinetic constants.Formula:C34H49N11O9Purezza:Min. 95%Peso molecolare:755.84 g/molH-FTVTVPK^-OH
Peptide H-FTVTVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH
Peptide H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Glu(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-D-Glu(OtBu)-Wang resin is a solid support for peptide synthesis. It is used to synthesize peptides with the Fmoc or O-benzyl protecting group. The resin has a 1% DVB content and an average particle size of 100-200 mesh.Purezza:Min. 95%Mob-S-Mercaptoproprionic acid
Mob-S-Mercaptoproprionic acid is a reagent that can be used to synthesize peptides. It is also a Building Block for the synthesis of other molecules. Mob-S-Mercaptoproprionic acid is hydrolyzed to form the corresponding carboxylate and mercaptoacyl amide, which can be used in peptide synthesis by condensation with an amino acid.
Formula:C11H14O3SPurezza:Min. 95%Peso molecolare:226.3 g/molH2N-Ser-Cys-Arg-Trp-Arg-Phe-Pro-Ala-Arg-Pro-Gly-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H96N22O15S1Peso molecolare:1,433.64 g/molMyr-SIYRRGARRWRKL-OH
Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-D-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-D-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is an amino acid resin with D,L-alanyl side chains, which can be cleaved by hydrochloric acid to release the desired amino acid and trityl resin. This resin is used in peptide synthesis reactions to provide a protecting group for the N-terminal amino acid.Purezza:Min. 95%Fmoc-Pro-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Pro-Wang Resin (100-200 mesh) is a resin that can be used for peptide synthesis. It is a building block for the synthesis of peptides, proteins and other organic compounds. Fmoc-Pro-Wang Resin (100-200 mesh) 1% DVB is an acid labile resin that is polymerized with N,N'-Dicyclohexylcarbodiimide and 4-(dimethylamino)pyridine to form a three dimensional crosslinked network. This resin has 100-200 mesh particle size and 1% DVB content.Purezza:Min. 95%Cyclo[Arg-Gly-Asp-D-Phe-Lys(Mal)]
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Mal)] is a peptide, or small protein, that has been shown to have anti-inflammatory and anti-tumor activities. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Mal)] is a cyclic peptide with three maleimidopropionic acid residues and contains the amino acid sequence Arg - Gly - Asp - D - Phe - Lys (Mal). The peptide has been shown to inhibit the production of nitric oxide in macrophages by blocking the release of arginase from these cells. This inhibition of arginase leads to decreased production of nitric oxide, which is an important mediator in inflammation. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Mal)] also inhibits tumor cell proliferation through its ability to inhibit protein synthesis and induce apoptosis.Formula:C34H46N10O10Purezza:Min. 95%Peso molecolare:754.81 g/molIL 2 Human
IL-2 is a cytokine that regulates the immune system. It is a protein that is produced by T lymphocytes and natural killer cells, and stimulates the production of other white blood cells. IL-2 has two receptor chains: an alpha chain that binds to IL-2 and a beta chain that binds to IL-2 with high affinity. The receptor chains are encoded by genes in the human major histocompatibility complex (MHC) on chromosome 6. IL-2 has been shown to be an activator of ion channels and ligand for antibody molecules. It also has been used as a research tool in cell biology and as an inhibitor for cancer treatment.br>br> IL 2 Human is a recombinant form of Interleukin 2, which is a type of immunotherapy that is used to treat cancer patients who have not responded well to chemotherapy or radiation therapy. This form of Interleukin 2 is purified from E. coli bacteria, which means it doesPurezza:Min. 95%H-MADDQGRGRRRPLNEDC-NH2
Peptide H-MADDQGRGRRRPLNEDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(Arg-Gly-Asp-D-Tyr-Cys)
Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is a peptide that is used as a research tool to study the activation of ion channels. It activates the channel by binding to the receptor and inducing conformational changes in it. Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is also used as an inhibitor of protein interactions, such as antibody and ligand interactions. CAS No.: 438286 28Formula:C24H34N8O8SPurezza:Min. 95%Peso molecolare:594.65 g/molH-WRQAAFVDSY-NH2
Peptide H-WRQAAFVDSY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanotan I
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C78H111N21O19Peso molecolare:1,646.9 g/molH-ALPAPIEKTISK-NH2
Peptide H-ALPAPIEKTISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
4-[D10]Leu-Insulin, human
The insulin receptor is a cell surface receptor that binds the hormone insulin, a peptide hormone. It belongs to the class of tyrosine kinase receptors and is activated by the binding of insulin to its extracellular alpha subunit. Insulin causes an increase in glucose uptake in muscle cells and adipocytes by stimulating the activity of several enzymes involved in carbohydrate metabolism. The insulin receptor also has ion channel activity and can activate potassium channels. Insulin receptors are found on many different cell types, including liver cells, fat cells, and brain cells. The protein is composed of two alpha subunits that form a disulfide bond to create a functional dimer. Insulin receptors have been used as research tools for studying protein interactions, ligands, and pharmacology.END>>
Formula:C257H343D40N65O77S6Purezza:Min. 95%Peso molecolare:5,847.8 g/molViloxazine hydrochloride - Bio-X ™
CAS:Viloxazine is a selective inhibitor for norepinephrine uptake over serotonin (5-HT) uptake in rat hypothalamic synaptosomes. It has been studied for its potential uses in treating attention-deficit hyperactivity disorder (ADHD) and depression.Viloxazine hydrochloride is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C13H19NO3•HClPurezza:Min. 95%Colore e forma:PowderPeso molecolare:273.76 g/molH-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is an acid-labile thiolated polystyrene resin with a low degree of substitution. The resin has been shown to be stable in the presence of strong acid, and can be used for the synthesis of peptides. This product contains 1% DVB as a protective colloid, which resists hydrolysis by acids and bases.Purezza:Min. 95%H-GTPTAENPEYLGL^DVPV-OH
Peptide H-GTPTAENPEYLGL^DVPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AIPELTK^-OH
Peptide H-AIPELTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.L-Pen(p-Me-Bzl)
L-Penicillamine (L-Pen) is a metabolite of penicillin and is the toxic from of penicillin’s two enantiomers L-Pen and D-Pen. While D-Pen is a clinically useful metal chelator protein with its ability to help treat Wilson’s diseases and possible Alzheimer’s disease, L-Pen can result in neuritis and marrow damage. It is important therefore that methods are developed, particularly in the pharmaceutical industry, to identify and eliminate the presence of L-Pen. One such method is using a chiral molecular imprinting technique.Formula:C13H19NO2SPurezza:Min. 95%Peso molecolare:253.2 g/molHistone H3 peptide (non-modified A.A. 1-44), biotin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFmoc-Ile-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Ile-Wang resin is a polystyrene resin which is used in the synthesis of peptides. It has a high loading capacity, and can be cleaved with hydrofluoric acid. The Fmoc-Ile-Wang resin contains 1% DVB as an acidic scavenger to prevent the formation of side products. The resin is also available in 100-200 mesh size.Purezza:Min. 95%Urokinase-Derived Peptide A6
Urokinase-Derived Peptide A6 (UDP-A6) is a protein derived from the urokinase enzyme. It has been shown to have antiproliferative effects on tumour cells and has been studied as a potential treatment for inflammatory diseases such as rheumatoid arthritis. The mechanism of action is not fully understood, but it is thought that UDP-A6 binds to a specific receptor on the surface of cells, called the leukocyte antigen, which causes them to stop proliferating. UDP-A6 has also been shown to bind to the surface glycoprotein of cancer cells and cause them to die.Formula:C39H62N10O15Purezza:Min. 95%Peso molecolare:910.99 g/molS961 TFA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C211H297N55O71S2Peso molecolare:4,804.13 g/molMu-Conotoxin GS
A synthetic cone snail toxin, sourced from the marine snail, Conus geographus. This product has disulfide bonds between Cys2-Cys14, Cys9-Cys19, and Cys13-Cys27 and is available as a 0.5mg vial.Formula:C136H226N52O48S7Purezza:Min. 95%Peso molecolare:3,618.1 g/molCyclo(Arg-Gly-Asp-D-Tyr-Glu)
Cyclo(Arg-Gly-Asp-D-Tyr-Glu) is a peptide macrocyclic compound that has been used as a radiolabeling agent for peptides. This compound is an analogue of cyclo(Arg-Gly-Asp), which is a biologically active peptide found in many cell surface receptors. Cyclo(Arg-Gly-Asp) has been shown to have antiangiogenic and antiapoptotic properties.Formula:C26H36N8O10Purezza:Min. 95%Peso molecolare:620.62 g/molHIV - 1 MN ENV - 205
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,515.7 g/molLysostaphin Recombinant
Lysostaphin is a bacteriolytic enzyme that is produced by the bacteria Staphylococcus simulans. It cleaves the cross-linked pentaglycine bridges in bacterial cell walls which are essential for their structural integrity. Lysostaphin displays a broad spectrum of activity against Gram-positive and Gram-negative bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). The recombinant form of lysostaphin has been expressed in E. coli and can be used to produce large quantities of lysostaphin for therapeutic use. Expression of lysostaphin in E. coli has also allowed for the production of other polypeptides with antimicrobial properties, such as the clostridial bacteriocins and staphylokinase.Purezza:>95% By Rp-HplcH-VVLHPNYSQVDIGL^IK-OH
Peptide H-VVLHPNYSQVDIGL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Asp(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Asp(OtBu)-Wang resin is a 1% DVB resin that can be used as an inhibitor of peptide synthesis. It has been shown to selectively inhibit the binding of the L-type calcium channel, which is a cell membrane protein that affects the transport of calcium ions in and out of cells. Fmoc-Asp(OtBu)-Wang resin binds to the receptor site, preventing the natural ligand from binding. This inhibition prevents the activation of ion channels and reduces calcium ion influx into cells, leading to an anti-inflammatory effect.Purezza:Min. 95%HXB2 gag NO-113/aa449 - 463
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,684.8 g/molH-KVLEYVIKV^-OH
Peptide H-KVLEYVIKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.KKALLALALHHLAHLALHLALALKKA
KKALLALALHHLAHLALHLALALKKA is an amphipathic peptide antibiotic that is able to selectively inhibit the growth of Gram-positive bacteria. It has been shown to be effective against a range of Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA), Clostridium perfringens, and Streptococcus pneumoniae. KKALLALALHHLAHLALHLALALKKA has also been shown to have biochemicals and peptides that are active in the treatment of bacterial infections.
Formula:C132H228N38O27Purezza:Min. 95%Peso molecolare:2,779.53 g/molSIVmac239 - 88
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,442.7 g/molFmoc-Trp-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is a peptide resin that is used in the solid phase synthesis of peptides and small molecules. This product has been shown to be an effective inhibitor for Ion channels, Receptor, Ligand, and even Cell Biology. It is also a high purity reagent that can be used in a variety of applications including Pharmacology and Protein interactions. The Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is available for purchase with CAS No. 680904-06-4.Purezza:Min. 95%HXB2 gag NO-70
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.9 g/molH-YLQPR^TFLL-OH
Peptide H-YLQPR^TFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTGMAFR^-OH
Peptide H-LTGMAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLYASKLS-NH2
Peptide H-GLYASKLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CLEAR-Acid Resin (100-200 mesh)
CLEAR-Acid Resin (100-200 mesh) is a high purity resin that is used for peptide synthesis. It has been used in research as an activator and inhibitor of protein interactions, such as receptor-ligand and antibody-antigen. CLEAR-Acid Resin (100-200 mesh) is often used in antibody production, where it binds to the antigen and activates the immune response against it. CLEAR-Acid Resin (100-200 mesh) has also been used for ion channel research due to its ability to inhibit potassium channels in neuronal cells. The CAS Number for CLEAR-Acid Resin (100-200 mesh) isPurezza:Min. 95%H-Asp(OtBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asp(OtBu)-2-ClTrt-Resin is a resin that is used for peptide synthesis. It can be used in the synthesis of building blocks, such as thiols, alcohols, amines, and so on. H-Asp(OtBu)-2-ClTrt-Resin can be found in the Tools for Peptide Synthesis category.
Purezza:Min. 95%Psalmotoxin 1
CAS:Psalmotoxin 1 is a peptide that is an activator of ion channels. It has been shown to bind to the acetylcholine receptor, nicotinic acetylcholine receptor, and the glycine receptor. It also inhibits protein interactions with its high-affinity binding affinity for the alpha-subunit of phospholipase A2.Formula:C200H318N62O57S6Purezza:Min. 95%Peso molecolare:4,695.42 g/molH-SPYVITGPGVVEYK^-OH
Peptide H-SPYVITGPGVVEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Cy3B]-LifeAct (Abp140 1-17)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130929.webp&w=3840&q=75)
![C-terminal Sortagging-[Cys(AF680)] amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101685.webp&w=3840&q=75)
![[FITC]-Ahx-(KKEEE)3K carrier peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100440.webp&w=3840&q=75)
![KLHY-[AMC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100970.webp&w=3840&q=75)
![Histone H3 (1-20)-GG-[Cys(AZ647)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101680.webp&w=3840&q=75)
![[5-FAM]-Tyr-Ahx-Ser-Asp-Lys-Pro-acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100398.webp&w=3840&q=75)
![Ac-RLR-[Rh110]-[D-Pro]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100532.webp&w=3840&q=75)
![Insulysin FRET substrate [Mca]/[Dnp]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100406.webp&w=3840&q=75)
![pp89 phosphoprotein fragment [Mouse cytomegalovirus 1]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1001233.webp&w=3840&q=75)
![[Nle4, D-Phe7]-ß-MSH-Amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPMC-3669-PI.webp&w=3840&q=75)
![Cyclo[Arg-Gly-Asp-D-Phe-Lys(Mal)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3795-PI.webp&w=3840&q=75)
![4-[D10]Leu-Insulin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3404-V.webp&w=3840&q=75)
