Peptidi
Sottocategorie di "Peptidi"
Trovati 29634 prodotti di "Peptidi"
H-GNNQQNY-OH
Peptide H-GNNQQNY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIAQDYGVLK-OH
Peptide H-TIAQDYGVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARTKQTARKSTGGKAY-OH
Peptide H-ARTKQTARKSTGGKAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVLQ-OH
Peptide H-SVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGNEIQYVALR-OH
Peptide H-VGNEIQYVALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQAAMQMLKDTINEE-OH
Peptide H-HQAAMQMLKDTINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVAVYADQAK-OH
Peptide H-AVAVYADQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ANLPQSFQVDTSK-OH
Peptide H-ANLPQSFQVDTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQELLELDKWASLWGGTETSQVAPA-OH
Peptide H-EQELLELDKWASLWGGTETSQVAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVEEIIEETK-OH
Peptide H-FVEEIIEETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RTVAAPSVFIFPPSDEQLK-OH
Peptide H-RTVAAPSVFIFPPSDEQLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YSKHTPINL-OH
Peptide H-YSKHTPINL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLDWIGIMSPVDSDIR-OH
Peptide H-GLDWIGIMSPVDSDIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ECYSVFTNR-OH
Peptide H-ECYSVFTNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVFLGMFLYEYAR-OH
Peptide H-DVFLGMFLYEYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TKAKRRVVQREKR-OH
Peptide H-TKAKRRVVQREKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LWVYNTQGYF-OH
Peptide H-LWVYNTQGYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAIVFKGL-OH
Peptide H-NAIVFKGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASGAFGTVYK-OH
Peptide H-ASGAFGTVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VISNDVCAQV-OH
Peptide H-VISNDVCAQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGIENVK-OH
Peptide H-YGIENVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFKNFNTATPSLE-OH
Peptide H-TFKNFNTATPSLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IYLPHSLPQQ-OH
Peptide H-IYLPHSLPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGTLLPLQK-OH
Peptide H-LGTLLPLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYLDSGIHF-OH
Peptide H-SYLDSGIHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILDFGLAR-OH
Peptide H-ILDFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAQ-OH
Peptide H-FAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVGAGDVGK-OH
Peptide H-VVGAGDVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLIQNSLTI-OH
Peptide H-RLIQNSLTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPIESHQVEK-OH
Peptide H-TPIESHQVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGPGRAFYA-OH
Peptide H-IGPGRAFYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIDQTPYK-OH
Peptide H-EIDQTPYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQGRIVGGK-OH
Peptide H-PQGRIVGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLAFPLTIR-OH
Peptide H-TLAFPLTIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEVTAYSPLGSSDR-OH
Peptide H-GLEVTAYSPLGSSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGI-OH
Peptide H-IGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPYV-OH
Peptide H-IPYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLQEERTCKV-OH
Peptide H-RLQEERTCKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLEVQGYW-OH
Peptide H-HLEVQGYW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLFLLFSL-OH
Peptide H-SLLFLLFSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TKAARKSAPAT-OH
Peptide H-TKAARKSAPAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NFNTVPYIVGINK-OH
Peptide H-NFNTVPYIVGINK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTQLGTFEDHFLSLQR-OH
Peptide H-LTQLGTFEDHFLSLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CERRKSPLQDPF-OH
Peptide H-CERRKSPLQDPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TCVADESAENCDK-OH
Peptide H-TCVADESAENCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEFAEVSK-OH
Peptide H-AEFAEVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KGK-OH
Peptide H-KGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRQPPRSISSHP-OH
Peptide H-RRQPPRSISSHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SWMESEFRVY-OH
Peptide H-SWMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYKDHDGDYKDHDIDYKDDDDK-OH
H-DYKDHDGDYKDHDIDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-DYKDDDDKDYKDDDDKDYKDDDDK-OH
H-DYKDDDDKDYKDDDDKDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH
H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C211H318N62O59S3Peso molecolare:4,763.42 g/molH-VSEHFSLLF-OH
Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIANFKIEPPGLFRGRGNHP-OH
Peptide H-RIANFKIEPPGLFRGRGNHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYATVIHDI-OH
H-LYATVIHDI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EITPEKNPQ-OH
Peptide H-EITPEKNPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKKKKKK-OH
Peptide H-KKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSDQIHFFFAK-OH
Peptide H-TSDQIHFFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSTLGLDIETATR-OH
H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-INWLKLGKMVIDAL-OH
H-INWLKLGKMVIDAL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C76H129N19O17SPeso molecolare:1,613.04 g/molH-AFLLTPR-OH
Peptide H-AFLLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSKKDKPLCKKHAHSVNF-OH
Peptide H-FSKKDKPLCKKHAHSVNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KTCPVQLWV-OH
Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGRPEWWMDYQKRYG-OH
H-VGRPEWWMDYQKRYG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C91H127N25O23SPeso molecolare:1,971.22 g/molH-GLADTVVAC-OH
Peptide H-GLADTVVAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSSAYSLQMGATAIKQVKKLFKKWGW-OH
Peptide H-KSSAYSLQMGATAIKQVKKLFKKWGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WRERQRQIRSISGWI-OH
Peptide H-WRERQRQIRSISGWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNLRRGIAL-OH
Peptide H-YNLRRGIAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNTANST-OH
Peptide H-VNTANST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFSDLWKLL-OH
Peptide H-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKKK-OH
CAS:Peptide H-KKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C54H110N18O10Peso molecolare:1,171.6 g/molH-YGGF-OH
Peptide H-YGGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QPAPENAYQAY-OH
Peptide H-QPAPENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAFRDLCIVY-OH
Peptide H-FAFRDLCIVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RALGPGATL-OH
Peptide H-RALGPGATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPPPKVIQ-OH
Peptide H-FPPPKVIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVIA-OH
Peptide H-VVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C30H46N6O9Peso molecolare:634.73 g/molH-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH
H-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-LDELLQSQIEK-OH
Peptide H-LDELLQSQIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Peptide H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C258H401N79O78Peso molecolare:5,857.5 g/molH-QIFNKPYWL-OH
Peptide H-QIFNKPYWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GCRDVPMSMRGGDRCG-OH
Peptide H-GCRDVPMSMRGGDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPQGFSAL-OH
Peptide H-DLPQGFSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITIRPR-OH
Peptide H-LSITIRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTSCVNPPTVQNAHILSR-OH
Peptide H-STDTSCVNPPTVQNAHILSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPGAAGYDL-OH
Peptide H-SPGAAGYDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSLAQEQVGGSPEK-OH
Peptide H-VLSLAQEQVGGSPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Myr-GSNKSKPK-NH2
Peptide H-Myr-GSNKSKPK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CCCC-OH
Peptide H-CCCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C12H22N4O5S4Peso molecolare:430.59 g/molH-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TGESAEFVCK-OH
Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPTPNVSVVDLTCR-OH
Peptide H-VPTPNVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEKARGSTY-OH
Peptide H-LEKARGSTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVYFCHLDIIW-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C109H163N25O32S5Peso molecolare:2,495.97 g/molH-GTVGGYFLAGR-OH
Peptide H-GTVGGYFLAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APENAYQAY-OH
Peptide H-APENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPLTNAIK-OH
Peptide H-FPLTNAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLSSLGLNAV-OH
Peptide H-KLSSLGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQSIQPFISR-OH
Peptide H-GQSIQPFISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGLSKGCFGLKLDRIGSMSGLGC-NH2
CAS:H-YGLSKGCFGLKLDRIGSMSGLGC-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C102H166N28O30S3Peso molecolare:2,360.8 g/molH-QSRGDENRGW-OH
Peptide H-QSRGDENRGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KVDDTFYYV-OH
Peptide H-KVDDTFYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RCVCRRGVCRCVCTRGFC-OH
H-RCVCRRGVCRCVCTRGFC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GCTVCG-OH
Peptide H-GCTVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPP-OH
Peptide H-PPPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LPPHDITPY-OH
Peptide H-LPPHDITPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKLITFILKKTREK-OH
Peptide H-KKLITFILKKTREK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STKKLSECLKRIGDELDSNM-OH
H-STKKLSECLKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TEMP-OH
Peptide H-TEMP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RQKRILVNL-OH
Peptide H-RQKRILVNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK-OH
Peptide H-QTALVELVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLSLEEIQK-OH
Peptide H-DLSLEEIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELVHFLLL-OH
Peptide H-AELVHFLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GMNEALEK-OH
Peptide H-GMNEALEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESLKMIF-OH
Peptide H-SESLKMIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WQYFFPVIF-OH
CAS:Peptide H-WQYFFPVIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YIIFVYIPL-OH
Peptide H-YIIFVYIPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPYF-OH
Peptide H-EPYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSMIR-OH
Peptide H-WYQSMIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KIRLRPGGKKKY-OH
Peptide H-KIRLRPGGKKKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNSAAFPAPIEK-OH
Peptide H-VNSAAFPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LIYRQPNCDDPETEEAALVAIDYIAPHGPG-OH
Peptide H-LIYRQPNCDDPETEEAALVAIDYIAPHGPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILGFVFTLTV-OH
Peptide H-ILGFVFTLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KNKESKDPADETEAD-OH
H-KNKESKDPADETEAD-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-REPVTKAEML-OH
Peptide H-REPVTKAEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISIDVNNNDIK-OH
Peptide H-ISIDVNNNDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WSPGGQML-OH
Peptide H-WSPGGQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSVPTSEWQR-OH
Peptide H-LSVPTSEWQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPRRNRWSKIWKKVVTVFS-NH2
Peptide H-LPRRNRWSKIWKKVVTVFS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEIKRY-OH
Peptide H-SELEIKRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILLARLFLY-OH
Peptide H-ILLARLFLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYGQPQSGSYSQQPS-OH
Peptide H-SYGQPQSGSYSQQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPPPPPP-OH
Peptide H-PPPPPPPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVGDWRK-OH
Peptide H-EVGDWRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALYLVCG-OH
Peptide H-EALYLVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLLWITAA-OH
Peptide H-VLLLWITAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-MSCCRSSRTRRETQL-OH
Peptide H-MSCCRSSRTRRETQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYSAGIVQI-OH
Peptide H-TYSAGIVQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNFNFNGL-OH
Peptide H-VNFNFNGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLDV-OH
Peptide H-DLDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGRYDEYRGCSPDGYGG-OH
Peptide H-GGRYDEYRGCSPDGYGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGVSCEVIDLR-OH
Peptide H-LGVSCEVIDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIHDIILEC-OH
Peptide H-TIHDIILEC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEGGVGWRHW-OH
Peptide H-AEGGVGWRHW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WVDGTDYETGFK-OH
Peptide H-WVDGTDYETGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVCGGIMFL-OH
Peptide H-TVCGGIMFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVDLSTFYQNR-OH
Peptide H-NVDLSTFYQNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEQNTLQEFLK-OH
H-AVEQNTLQEFLK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C63H102N16O21Peso molecolare:1,419.6 g/molH-SLMDLLSSL-OH
Peptide H-SLMDLLSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS:H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C148H223N39O46Peso molecolare:3,284.63 g/molH-LLLLLLLLLLKKK-NH2
Peptide H-LLLLLLLLLLKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTDVSNMSHLA-OH
Peptide H-YTDVSNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLNEKDYELLCLDGTR-OH
Peptide H-NLNEKDYELLCLDGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAPVAIPQ-OH
Peptide H-NAPVAIPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLYRLFRKSNLKPFE-OH
Peptide H-YLYRLFRKSNLKPFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNLELLR-OH
Peptide H-SNLELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGIGKIGDFIKKAIAKYKN-OH
H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KRPPIFIRRL-OH
Peptide H-KRPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFLINETAR-OH
Peptide H-NFLINETAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER-OH
Peptide H-IDEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQKLVFFA-NH2
Peptide H-HQKLVFFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK-OH
Peptide H-IPNAGQMQPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCSSCPLSK-OH
Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPAPITR-OH
Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESIKKKVL-OH
Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLDTASTTL-OH
Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESGQFHAF-OH
Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYLYDSETK-OH
Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KIGAKIKIGAKIKIGAKI-OH
Peptide H-KIGAKIKIGAKIKIGAKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHQKLVFF-NH2
Peptide H-HHQKLVFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YICEEASVTV-OH
Peptide H-YICEEASVTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SEVAHR-OH
Peptide H-SEVAHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELLHAPATV-OH
Peptide H-ELLHAPATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAAA-OH
Peptide H-AAAAAAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLPEVEVPQHL-OH
H-RLPEVEVPQHL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C59H97N17O17Peso molecolare:1,316.52 g/molH-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH
CAS:H-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C149H221N37O49Peso molecolare:3,314.61 g/molH-VFSVSLSNPSTGK-OH
Peptide H-VFSVSLSNPSTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDS-NH2
Peptide H-DAEFRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLDKGTYTL-OH
H-FLDKGTYTL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EQQCVIMAENR-OH
Peptide H-EQQCVIMAENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGSEAYNQQLSEK-OH
Peptide H-IGSEAYNQQLSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFPIYDFLPAKKK-OH
H-EFPIYDFLPAKKK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-YPRNPTEQGNI-OH
Peptide H-YPRNPTEQGNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RFDNPVLPF-OH
Peptide H-RFDNPVLPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKKCDKKCIEWEKAQHGA-OH
Peptide H-NKKCDKKCIEWEKAQHGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELFADKVPKTAENFR-OH
Peptide H-ELFADKVPKTAENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TANDLNLLILR-OH
Peptide H-TANDLNLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
