Peptidi
Sottocategorie di "Peptidi"
Trovati 29610 prodotti di "Peptidi"
H-FTDEYQLYEDIGK-OH
Peptide H-FTDEYQLYEDIGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLIGDCATV-OH
Peptide H-TLIGDCATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCSRNRQYL-OH
Peptide H-KCSRNRQYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIMYNYPAM-OH
Peptide H-QIMYNYPAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLEEMFLT-OH
Peptide H-SLLEEMFLT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIIFNNGPTWK-OH
Peptide H-GIIFNNGPTWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLEAELLVLR-OH
Peptide H-VLEAELLVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFEAIEGFIENGWEGMIDGWYG-OH
Peptide H-GLFEAIEGFIENGWEGMIDGWYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.L-Norleucine
CAS:Formula:C6H13NO2Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:131.184-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium Chloride
CAS:Formula:C10H17ClN4O3Purezza:>85.0%(qNMR)Colore e forma:White to Almost white powder to crystalPeso molecolare:276.72Cyclo(Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate
CAS:Cyclo(Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate is a cyclic peptide, which functions as an integrin receptor antagonist. It is synthesized through solid-phase peptide synthesis, utilizing a sequence based on known integrin-binding motifs. The cyclic structure confers greater stability and binding affinity compared to linear counterparts.
Formula:C27H41N9O7•(C2HF3O2)xPurezza:Min. 95%H-CSSSIINFEKL-OH
Modified H-2kb tetramer peptide for further modification (e.g. addition of N-term tag)N-(4-Fluorophenyl)glycine
CAS:Formula:C8H8FNO2Purezza:>98.0%(GC)(T)Colore e forma:White to Light yellow powder to crystalPeso molecolare:169.16H-AAVVRFQEAANKQKQ-OH
Peptide H-AAVVRFQEAANKQKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C73H120N24O21Peso molecolare:1,687.9 g/molH-GLSNLTHVL-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolEpitope1- I80-N92-B
90%; Research Peptide matching Epitope1- I80-N92-BFormula:C77H131N23O22S2Colore e forma:PowderPeso molecolare:1,813.15 g/molH-KLVELEHTL-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-CQGQPERDEKIKEPT-OH Acetate salt
Please enquire for more information about H-CQGQPERDEKIKEPT-OH Acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pagehBID peptide
BH3 interacting-domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family. BID is a BH3-only protein that connects the extrinsic TNFR1 and Fas death signaling pathway to the mitochondrial amplification cascade of the intrinsic death pathway. BID is believed to activate multidomain pro-apoptotic proteins BAX or BAK directly. hBID peptide is a 21 amino acid amide from the human protein BID. BID is BH3-interacting domain death agonist. This hBID peptide encompasses the BH3 motif containing the conserved LXXXXD, which is required for BID for pro-apoptotic activity and to interact with anti-apoptotic members of the Bcl-2 family. It is a useful reagent for BH3 profiling,N-(tert-Butoxycarbonyl)-4-chloro-D-phenylalanine
CAS:Formula:C14H18ClNO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:299.75H-PKEK-OH
Please enquire for more information about H-PKEK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:Min. 95%H-EVDPASNTY-OH
Peptide H-EVDPASNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNQLESK-OH
Peptide H-LNQLESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRRATLG-OH
Peptide H-LRRATLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLMWITQA-OH
Peptide H-SLLMWITQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGDPPLPTL-OH
Peptide H-GGDPPLPTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFTPQVQAAYQK-OH
Peptide H-EFTPQVQAAYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IEVSQLLK-OH
Peptide H-IEVSQLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPVIGPLK-OH
Peptide H-IPVIGPLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TAVPWNASW-OH
Peptide H-TAVPWNASW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDFQFNISR-OH
Peptide H-GDFQFNISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Beta-Amyloid (1-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C203H311N55O60SPeso molecolare:4,514.04 g/molH-KKKKKAAAC-OH
Peptide H-KKKKKAAAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSFPSCCFSIAVIFM-OH
Peptide H-VSFPSCCFSIAVIFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALKDVEERV-OH
Peptide H-ALKDVEERV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGAHLQGGAK-OH
Peptide H-AGAHLQGGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYWGQGTEL-OH
Peptide H-DYWGQGTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLSRYVARL-OH
Peptide H-GLSRYVARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EYFYTSGK-OH
Peptide H-EYFYTSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALFDIESKV-OH
Peptide H-ALFDIESKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TKSSLPGQTK-OH
Peptide H-TKSSLPGQTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STAENAEYLRVAP-OH
Peptide H-STAENAEYLRVAP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLRFLYEG-OH
Peptide H-SLRFLYEG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYDFAFRDL-OH
Peptide H-VYDFAFRDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGIQNSVSA-OH
Peptide H-CGIQNSVSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLRPGGKKK-OH
Peptide H-RLRPGGKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WDLAWMFRLPVG-OH
Peptide H-WDLAWMFRLPVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSLPWQGLK-OH
Peptide H-TSLPWQGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIVYPWTQR-OH
Peptide H-LLIVYPWTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPAIQNLALR-OH
Peptide H-FPAIQNLALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LKKTET-OH
Peptide H-LKKTET-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAVYLQMTDLR-OH
Peptide H-SAVYLQMTDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDVHYAPTIR-OH
Peptide H-LDVHYAPTIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FATNTTLTK-OH
Peptide H-FATNTTLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPLVEEPQNLIK-OH
Peptide H-VFDEFKPLVEEPQNLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-INPASLDK-OH
Peptide H-INPASLDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C37H62N10O12Peso molecolare:856.96 g/molH-VVLSFELLHAPATVC-OH
Peptide H-VVLSFELLHAPATVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STGGISVPGPMGPSGPR-OH
Peptide H-STGGISVPGPMGPSGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSLANPGIA-OH
Peptide H-NSLANPGIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQNSLTIERMVLSAF-OH
Peptide H-IQNSLTIERMVLSAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVTSIHSLLDEGKQS-OH
Peptide H-NVTSIHSLLDEGKQS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVIDPVPAPVGDSHVDGAAK-OH
Peptide H-SVIDPVPAPVGDSHVDGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGAQASSTPLSPTR-OH
Peptide H-SGAQASSTPLSPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVESLPQEIK-OH
Peptide H-LVESLPQEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDYKDDDDK-OH
Peptide H-CDYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISEQTYQLSR-OH
Peptide H-ISEQTYQLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLYTYWSAGE-OH
Peptide H-GLYTYWSAGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YYIAASYVK-OH
Peptide H-YYIAASYVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CTPYDINQM-OH
Peptide H-CTPYDINQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SISIVGSYVGNR-OH
Peptide H-SISIVGSYVGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALLGDFFR-OH
Peptide H-FALLGDFFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QPYLFATDSLIK-OH
Peptide H-QPYLFATDSLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNLEALEDFEK-OH
Peptide H-NNLEALEDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAVEEVSLR-OH
Peptide H-LAVEEVSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIDIGNYTV-OH
Peptide H-YIDIGNYTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLVQSGAEV-OH
Peptide H-QLVQSGAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSIQDWVQK-OH
Peptide H-VTSIQDWVQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QAIRETVEL-OH
Peptide H-QAIRETVEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VADFGLARLIEDNEYTARQGAK-OH
Peptide H-VADFGLARLIEDNEYTARQGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPASNLGLEDIIRKALMGSFDDK-OH
Peptide H-DPASNLGLEDIIRKALMGSFDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EEKRGSLYVW-OH
Peptide H-EEKRGSLYVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YKEGYNVYG-OH
Peptide H-YKEGYNVYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAVVNQIAR-OH
Peptide H-VAVVNQIAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSSRR-OH
Peptide H-RSSRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFERFEIFPKI-OH
Peptide H-SFERFEIFPKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQ-OH
Peptide H-AQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDK-OH
Peptide H-RGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KVSIWNLDY-OH
Peptide H-KVSIWNLDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLLDGLRAQ-OH
Peptide H-YLLDGLRAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLWQWRKSL-OH
Peptide H-DLWQWRKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRKGQRDLYSGLNQRRI-OH
Peptide H-IRKGQRDLYSGLNQRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AIK-AMC
Peptide Ac-AIK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHVQFFDDSPTR-OH
Peptide H-VHVQFFDDSPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARKSTGGKAPRKQLC-OH
Peptide H-ARKSTGGKAPRKQLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDTYPAELYITGSILR-OH
Peptide H-GDTYPAELYITGSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYSPSNVKI-OH
Peptide H-KYSPSNVKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RFPLTFGWCF-OH
Peptide H-RFPLTFGWCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aprotinin
Peptide Aprotinin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:6,511.6 g/molH-ERDQKLSELDDRADAL-OH
Peptide H-ERDQKLSELDDRADAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFDSLTLLASGR-OH
Peptide H-LFDSLTLLASGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GHQAAMQMLKETINE-OH
Peptide H-GHQAAMQMLKETINE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNDTTLQVLNTWYTK-OH
Peptide H-LNDTTLQVLNTWYTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bivalirudin
Peptide Bivalirudin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIEHGIVTNWDDMEK-OH
Peptide H-YPIEHGIVTNWDDMEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STIQNPYVAALYK-OH
Peptide H-STIQNPYVAALYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YYSTAASSL-OH
Peptide H-YYSTAASSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DALSSVQESQVAQQAR-OH
Peptide H-DALSSVQESQVAQQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VESTAGSL-OH
Peptide H-VESTAGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTLFQIFSK-OH
Peptide H-YTLFQIFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSFIEDLLF-OH
Peptide H-RSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SYSMEAAAAGKPVGKKRRPVKVYP-OH
Peptide H-SYSMEAAAAGKPVGKKRRPVKVYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Enterotoxin STh
Peptide Enterotoxin STh is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecolare:2,042.29 g/molH-VSQYIEWLQK-OH
Peptide H-VSQYIEWLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGAPGVEEIK-OH
Peptide H-IGAPGVEEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYNKANAFL-OH
Peptide H-KYNKANAFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HHGPTITAK-OH
Peptide H-HHGPTITAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLNESLIDL-OH
Peptide H-NLNESLIDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEAEVQIDR^-OH
Peptide H-VEAEVQIDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRFYKSLRAEQTD-OH
Peptide H-DRFYKSLRAEQTD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGICNQNII-OH
Peptide H-TGICNQNII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHFANLK-OH
Peptide H-SHFANLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSTIALALGVER-OH
Peptide H-LSTIALALGVER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLRLIHYSY-OH
Peptide H-GLRLIHYSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DITPTLTLYVGK-OH
Peptide H-DITPTLTLYVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPKPPKPVSKMRMATPLLMQALPM-OH
Peptide H-LPKPPKPVSKMRMATPLLMQALPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LMLIWYRPV-OH
Peptide H-LMLIWYRPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRTPSLPTPPTR-OH
Peptide H-SRTPSLPTPPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVFFAEDVGSDK-OH
Peptide H-LVFFAEDVGSDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HISAENTK-OH
Peptide H-HISAENTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVPWPNETL-OH
Peptide H-TVPWPNETL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLRSSVPGVRL-OH
Peptide H-RLRSSVPGVRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGSLQPLALEGSLQKRG-OH
Peptide H-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLAFIQDPDGYWIEILNPNK-OH
Peptide H-GLAFIQDPDGYWIEILNPNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TITSSYYR-OH
Peptide H-TITSSYYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WFSAGLASNSSWLR-OH
Peptide H-WFSAGLASNSSWLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH
Peptide H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPLPQGQLTAY-OH
Peptide H-EPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVVAVIGLPNDPSVR-OH
Peptide H-SVVAVIGLPNDPSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VIEHIMEDLDTNADK-OH
Peptide H-VIEHIMEDLDTNADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LKEFGNTLEDK-OH
Peptide H-LKEFGNTLEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPQDLNTML-OH
Peptide H-TPQDLNTML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLYTYWSAGA-OH
Peptide H-GLYTYWSAGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLLLGAGESGK-OH
Peptide H-LLLLGAGESGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASTIEMPQQAR-OH
Peptide H-ASTIEMPQQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PIPEQPQPY-OH
Peptide H-PIPEQPQPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLDDFAMHWV-OH
Peptide H-TLDDFAMHWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGIVSGFGR-OH
Peptide H-TGIVSGFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DEPPQSPWDR-OH
Peptide H-DEPPQSPWDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RHFWQQDEPPQSPWDR-OH
Peptide H-RHFWQQDEPPQSPWDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYYSLK-OH
Peptide H-GFYYSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLVVSDLFTER-OH
Peptide H-SLLVVSDLFTER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YEVQGEVFTKPQLWP-OH
Peptide H-YEVQGEVFTKPQLWP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYTVDLGR-OH
Peptide H-VYTVDLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLTWQELYQLKYKGI-OH
CAS:Peptide H-KLTWQELYQLKYKGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C92H143N21O23Peso molecolare:1,911.25 g/molH-KEVNSQLSL-OH
Peptide H-KEVNSQLSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPSSGPQDTRTT-OH
Peptide H-VPSSGPQDTRTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IDKISDVSTIVPYIGPALNI-OH
Peptide H-IDKISDVSTIVPYIGPALNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YFPLQSYGFQPTNGVGYQPYRVVVL-OH
Peptide H-YFPLQSYGFQPTNGVGYQPYRVVVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLMISR-OH
Peptide H-TLMISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGV-OH
Peptide H-DGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecolare:289.3 g/molH-LPTQNITFQTESSVAEQEAEFQSPK-OH
Peptide H-LPTQNITFQTESSVAEQEAEFQSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAVEEVSLRK-OH
Peptide H-LAVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPSKPSKRSFIEDLL-OH
Peptide H-DPSKPSKRSFIEDLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSAYERMCNILKGK-OH
Peptide H-RSAYERMCNILKGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNALKPDNR-OH
Peptide H-LNALKPDNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLDE-OH
Peptide H-FLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLIYDASNLETGVPSR-OH
Peptide H-LLIYDASNLETGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPSWEPFR-OH
Peptide H-SPSWEPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QSLGELIGTLNAAK-OH
Peptide H-QSLGELIGTLNAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GHQAAMQML-OH
Peptide H-GHQAAMQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLVPDSLYV-OH
Peptide H-KLVPDSLYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYIPSAEKI-OH
Peptide H-SYIPSAEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYGAEIVSALEYLHSR-OH
Peptide H-FYGAEIVSALEYLHSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QSPEDVYFSK-OH
Peptide H-QSPEDVYFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLGPISGHV-OH
Peptide H-VLGPISGHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QRLSTGSRINSAKDDAAGLQIA-OH
Peptide H-QRLSTGSRINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEEILTR-OH
Peptide H-FEEILTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IMDRYRVRNGDRIHIRLR-OH
Peptide H-IMDRYRVRNGDRIHIRLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFFYGGSRGKRNNFKTEEYC-OH
Peptide H-TFFYGGSRGKRNNFKTEEYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLTSEDEYNLLSDR-OH
Peptide H-VLTSEDEYNLLSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGPFSDSYR-OH
Peptide H-GGPFSDSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RTYTYEKL-OH
Peptide H-RTYTYEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GMNYLEDR-OH
Peptide H-GMNYLEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FCIGRL-OH
Peptide H-FCIGRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTYTGAIKL-OH
Peptide H-LTYTGAIKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPDLSSDIK-OH
Peptide H-EPDLSSDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYEAFSK-OH
Peptide H-FYEAFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEGGEEGKRNRVTLADLC-OH
Peptide H-EEGGEEGKRNRVTLADLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DNYPKLEEMMLLSNGC-OH
Peptide H-DNYPKLEEMMLLSNGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HPDASVNFSEFSK-OH
Peptide H-HPDASVNFSEFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SEQLGGDVESYDK-OH
Peptide H-SEQLGGDVESYDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGHLDLSGNR-OH
Peptide H-ALGHLDLSGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRVYIAPF-OH
Peptide H-DRVYIAPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTFEYVSQPFLMDLE-OH
Peptide H-CTFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIWLSSPSSGPK-OH
Peptide H-QIWLSSPSSGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDAAYCFR-OH
Peptide H-ALDAAYCFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFVNITPAEVGVLVGK-OH
Peptide H-TFVNITPAEVGVLVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVPYPQR-OH
Peptide H-AVPYPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGFFYTPKTRRE-OH
Peptide H-RGFFYTPKTRRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QDPDNTDDNGPQDPDNTDDN-OH
Peptide H-QDPDNTDDNGPQDPDNTDDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
