Peptidi
Sottocategorie di "Peptidi"
Trovati 29610 prodotti di "Peptidi"
H-LEAFLTQK-OH
Peptide H-LEAFLTQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFGFVGG-OH
Peptide H-GFGFVGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SINIGPGQVFYRTGD-OH
Peptide H-SINIGPGQVFYRTGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH
Peptide H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DFLAGGVAAAISK-OH
Peptide H-DFLAGGVAAAISK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GREDV-OH
Peptide H-GREDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HHAAYVNNLNVTEEK-OH
Peptide H-HHAAYVNNLNVTEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPLPQGQLTAY-OH
Peptide H-EPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEEISEVK-OH
Peptide H-TEEISEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HNLGHGHK-OH
Peptide H-HNLGHGHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSSASDYNSSELK-OH
Peptide H-VSSASDYNSSELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPMLKE-OH
Peptide H-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPYVITGPGVVEYK-OH
Peptide H-SPYVITGPGVVEYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSRVPDLLV-OH
Peptide H-SSRVPDLLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHRYRLAIQLHASDSSSSCV-OH
Peptide H-SHRYRLAIQLHASDSSSSCV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPRRIRQGL-OH
Peptide H-IPRRIRQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CPTGGFNWRETLLQE-OH
Peptide H-CPTGGFNWRETLLQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LCKLSL-OH
Peptide H-LCKLSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQLWCLSN-OH
Peptide H-SQLWCLSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSTAENAEYLR-OH
Peptide H-GSTAENAEYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFPFYGDYGSNYLYDN-OH
Peptide H-EFPFYGDYGSNYLYDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTFGWCFKLVPVEPE-OH
Peptide H-LTFGWCFKLVPVEPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IMDRYRVRNGDRIHIRLR-OH
Peptide H-IMDRYRVRNGDRIHIRLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEEILTR-OH
Peptide H-FEEILTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSFEDSVISLSGDHSIIGR-OH
Peptide H-VSFEDSVISLSGDHSIIGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QRLSTGSRINSAKDDAAGLQIA-OH
Peptide H-QRLSTGSRINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGDYGSLSGR-OH
Peptide H-VGDYGSLSGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KALGPAATL-OH
Peptide H-KALGPAATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASLFSFK-OH
Peptide H-ASLFSFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QSLGELIGTLNAAK-OH
Peptide H-QSLGELIGTLNAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEDTIFLR-OH
Peptide H-TEDTIFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KIIDLVHLL-OH
Peptide H-KIIDLVHLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIYDGDLK-OH
Peptide H-GIYDGDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFKQSSKAL-OH
Peptide H-GFKQSSKAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MHAINGR-OH
Peptide H-MHAINGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APIIAVTR-OH
Peptide H-APIIAVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLDDFAMHWV-OH
Peptide H-TLDDFAMHWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTFSNIK-OH
Peptide H-VTFSNIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGINYWLAHK-OH
Peptide H-VGINYWLAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EKFRVGNCKHLKMTRP-OH
Peptide H-EKFRVGNCKHLKMTRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDSFLQR-OH
Peptide H-EDSFLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTPEIPAGLPSPR-OH
Peptide H-VTPEIPAGLPSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSPVLIDFFEDTER-OH
Peptide H-DSPVLIDFFEDTER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STLQEQIGWMTNNPP-OH
Peptide H-STLQEQIGWMTNNPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVRI-OH
Peptide H-AVRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HIATNAVLFFGR-OH
Peptide H-HIATNAVLFFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPTQNITFQTESSVAEQEAEFQSPK-OH
Peptide H-LPTQNITFQTESSVAEQEAEFQSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-REEMEVHEL-OH
Peptide H-REEMEVHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLSWVALFD-OH
Peptide H-LLSWVALFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDNSLK-OH
Peptide H-YDNSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPHERNGFTVL-OH
Peptide H-RPHERNGFTVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFSLQWGEVK-OH
Peptide H-VFSLQWGEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGGPGAGSLQPLALE-OH
Peptide H-LGGGPGAGSLQPLALE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TIVTTLQDSIR-OH
Peptide H-TIVTTLQDSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRWIILGLNK-OH
Peptide H-KRWIILGLNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTVPVFYPTEK-OH
Peptide H-EVTVPVFYPTEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGE-OH
Peptide H-EGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVLATGLR-OH
Peptide H-LVLATGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSGAFGTVYK-OH
Peptide H-GSGAFGTVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFSIIHTPILPL-OH
Peptide H-SFSIIHTPILPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVMEYLPSGCLR-OH
Peptide H-LVMEYLPSGCLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MGARASVLSGGELDR-OH
Peptide H-MGARASVLSGGELDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGV-OH
Peptide H-DGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecolare:289.3 g/molH-TLMISR-OH
Peptide H-TLMISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YFPLQSYGFQPTNGVGYQPYRVVVL-OH
Peptide H-YFPLQSYGFQPTNGVGYQPYRVVVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IDKISDVSTIVPYIGPALNI-OH
Peptide H-IDKISDVSTIVPYIGPALNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPSSGPQDTRTT-OH
Peptide H-VPSSGPQDTRTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLIDSLIDFLNFPR-OH
Peptide H-HLIDSLIDFLNFPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYVEINGEK-OH
Peptide H-DYVEINGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSENLKSLYN-OH
Peptide H-GSENLKSLYN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CALNN-OH
Peptide H-CALNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITLAIPVNKPGR-OH
Peptide H-LITLAIPVNKPGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISPRITNAW-OH
Peptide H-ISPRITNAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSKGR-OH
Peptide H-SSKGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNWKWWPGIFD-OH
Peptide H-SNWKWWPGIFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGIVSGFGR-OH
Peptide H-TGIVSGFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVPWCFFPQSVEDCHY-OH
Peptide H-EVPWCFFPQSVEDCHY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLPDHINIV-OH
Peptide H-FLPDHINIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLEGSDDAVLLQR-OH
Peptide H-SLEGSDDAVLLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PIVTDKEKPVNIETE-OH
Peptide H-PIVTDKEKPVNIETE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLVPMIATV-OH
Peptide H-NLVPMIATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLWGPRALI-OH
Peptide H-FLWGPRALI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKRRPVKVYP-OH
Peptide H-KKRRPVKVYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ERPPPVPNPDYEPIR-OH
Peptide H-ERPPPVPNPDYEPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVALQTMKQ-OH
Peptide H-GVALQTMKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLPVPQK-OH
Peptide H-VLPVPQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFrY-OH
Peptide H-GFrY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EPFRDYVDRFYKTLR-OH
Peptide H-EPFRDYVDRFYKTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLKDQQLL-OH
Peptide H-YLKDQQLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRILQQLL-OH
Peptide H-IRILQQLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HHHHHHY-OH
Peptide H-HHHHHHY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSSANNCTF-OH
Peptide H-YSSANNCTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTAIGGAYNVGR-OH
Peptide H-GTAIGGAYNVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ-OH
Peptide H-TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SRIAVSYQ-OH
Peptide H-SRIAVSYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLTRFLSRV-OH
Peptide H-RLTRFLSRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGFANELGPRLMGK-OH
Peptide H-SGFANELGPRLMGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TITSTYYR-OH
Peptide H-TITSTYYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVIDPVPAPVGDSHVDGAAK-OH
Peptide H-SVIDPVPAPVGDSHVDGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVPDYA-OH
Peptide H-DVPDYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YFSLPSVVFAR-OH
Peptide H-YFSLPSVVFAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYTVDLGR-OH
Peptide H-VYTVDLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QQTVTLLPAADLDDFSK-OH
Peptide H-QQTVTLLPAADLDDFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SCLENFRAYV-OH
Peptide H-SCLENFRAYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLTWQELYQLKYKGI-OH
CAS:Peptide H-KLTWQELYQLKYKGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C92H143N21O23Peso molecolare:1,911.25 g/molH-SYFILRRRRKRFPYFFTDVRVAA-OH
Peptide H-SYFILRRRRKRFPYFFTDVRVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYSNTHSTRYV-OH
Peptide H-DYSNTHSTRYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGTTSTLQEQIGWMT-OH
Peptide H-AGTTSTLQEQIGWMT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KEVNSQLSL-OH
Peptide H-KEVNSQLSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLNVTLSSTGR-OH
Peptide H-GLNVTLSSTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLLDTASALYR-OH
Peptide H-DLLDTASALYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IASNTQSR-OH
Peptide H-IASNTQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NKSKKKAQQAAADTG-OH
Peptide H-NKSKKKAQQAAADTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRQDILDLWVY-OH
Peptide H-RRQDILDLWVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GERQNATEI-OH
Peptide H-GERQNATEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLLPSLATV-OH
Peptide H-FLLPSLATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGAQATWTELPWPHEK-OH
Peptide H-SGAQATWTELPWPHEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDLYVSDAFHK-OH
Peptide H-DDLYVSDAFHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PIPEQPQPY-OH
Peptide H-PIPEQPQPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRRQRRKKRGYGGDHWIHFTANWV-OH
Peptide H-RRRQRRKKRGYGGDHWIHFTANWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLLDGFMITL-OH
Peptide H-QLLDGFMITL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PKPPKPVSKMRMATPLLMQA-OH
Peptide H-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIT-OH
Peptide H-FIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAVEEVSLRK-OH
Peptide H-LAVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAIYEEFLR-OH
Peptide H-VAIYEEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFIIDPGGVIR-OH
Peptide H-GTFIIDPGGVIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SQVTNPANI-OH
Peptide H-SQVTNPANI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLFNTVATL-OH
Peptide H-SLFNTVATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVINGNPITIFQER-OH
Peptide H-LVINGNPITIFQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SISIVGSYVGNR-OH
Peptide H-SISIVGSYVGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGADTSVDLEETGR-OH
Peptide H-ILGADTSVDLEETGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CAKSANKNKKNKDKEYYV-OH
Peptide H-CAKSANKNKKNKDKEYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGLDAASYYAPVR-OH
Peptide H-DGLDAASYYAPVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TNPLIRHENRMVLASTTAKA-OH
Peptide H-TNPLIRHENRMVLASTTAKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASQSIGTNIHWYQQR-OH
Peptide H-ASQSIGTNIHWYQQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VALPHRTAC-OH
Peptide H-VALPHRTAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLQEILHGAVR-OH
Peptide H-NLQEILHGAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VITPGTNTSNQVAVL-OH
Peptide H-VITPGTNTSNQVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVLSFELL-OH
Peptide H-VVLSFELL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSSYWYAFNNKTGGGGC-OH
Peptide H-HSSYWYAFNNKTGGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFNAGEFSL-OH
Peptide H-TFNAGEFSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIEHIMEDLDTNADK-OH
Peptide H-VIEHIMEDLDTNADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AYPPGAPPMPPF-OH
Peptide H-AYPPGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CNFSGWQSC-OH
Peptide H-CNFSGWQSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NELESYAYSLK-OH
Peptide H-NELESYAYSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLSIPAVFFWR-OH
Peptide H-YLSIPAVFFWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTGHGAEDSLADQAANK-OH
Peptide H-LTGHGAEDSLADQAANK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTAFTIPSV-OH
Peptide H-YTAFTIPSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KAALDLSHF-OH
Peptide H-KAALDLSHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNALKPDNR-OH
Peptide H-LNALKPDNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIINTLQK-OH
Peptide H-GIINTLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVFELSDEK-OH
Peptide H-GVFELSDEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSPLLRYAAWTGGLA-OH
Peptide H-TSPLLRYAAWTGGLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRREILSRRPSYR-OH
Peptide H-KRREILSRRPSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQFNSTYR-OH
Peptide H-EEQFNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPTANVSVVDLTCR-OH
Peptide H-VPTANVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFFAPTR-OH
Peptide H-LLFFAPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPSAPPQWLTNT-OH
Peptide H-YPSAPPQWLTNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADDGRPFPQVIK-OH
Peptide H-ADDGRPFPQVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQEDDLAAGLSWIPF-OH
Peptide H-VQEDDLAAGLSWIPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RWYFYYLGT-OH
Peptide H-RWYFYYLGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDKNADGWIEFEEL-OH
Peptide H-GDKNADGWIEFEEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLVPDSLYV-OH
Peptide H-KLVPDSLYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVRFQEAANKQKQEL-OH
Peptide H-VVRFQEAANKQKQEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APQPELPYPQPGS-OH
Peptide H-APQPELPYPQPGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIPAWVPFDPAAQITK-OH
Peptide H-EIPAWVPFDPAAQITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HSGFEDELSEVLENQSSQAELK-OH
Peptide H-HSGFEDELSEVLENQSSQAELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASHLGLAR-OH
Peptide H-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGHPAPNFK-OH
Peptide H-IGHPAPNFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IHSLLDEGKQSLTKL-OH
Peptide H-IHSLLDEGKQSLTKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYVTIPLGIK-OH
Peptide H-LYVTIPLGIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIIQFVHGEEDLK-OH
Peptide H-NIIQFVHGEEDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQPANDPSWYTG-OH
Peptide H-HQPANDPSWYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPMTYKAAL-OH
Peptide H-RPMTYKAAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDVTTQVALQPALK-OH
Peptide H-GDVTTQVALQPALK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGYETFR-OH
Peptide H-SGYETFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTYQRTRAL-OH
Peptide H-TTYQRTRAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RKRTLRRL-OH
Peptide H-RKRTLRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APNVVVTR-OH
Peptide H-APNVVVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQFNEAQLALIR-OH
Peptide H-EQFNEAQLALIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSEY-OH
Peptide H-CSEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MTEQQWNFAGIEA-OH
Peptide H-MTEQQWNFAGIEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLGGSQQLLHNK-OH
Peptide H-HLGGSQQLLHNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLAFIQDPDGYWIEILNPNK-OH
Peptide H-GLAFIQDPDGYWIEILNPNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVAQGVGIPEDSIFTMADR-OH
Peptide H-VVAQGVGIPEDSIFTMADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLRSSVPGVRL-OH
Peptide H-RLRSSVPGVRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALILTLVS-OH
Peptide H-ALILTLVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIEVQGFR-OH
Peptide H-DIEVQGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASFHIPQVQVR-OH
Peptide H-ASFHIPQVQVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVNELTEFAK-OH
Peptide H-LVNELTEFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSSVPNTGTAR-OH
Peptide H-DSSVPNTGTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APEPVEIR-OH
Peptide H-APEPVEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTFELSR-OH
Peptide H-YTFELSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKLPAA-OH
Peptide H-RKLPAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IHWESASLLR-OH
Peptide H-IHWESASLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PTDNYITTY-OH
Peptide H-PTDNYITTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFGSGFGGGY-OH
Peptide H-SFGSGFGGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSYRRVPGI-OH
Peptide H-SSYRRVPGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLADEFIIPGLK-OH
Peptide H-VLADEFIIPGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDVYNGLL-OH
Peptide H-ALDVYNGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
