
Peptidi
Sottocategorie di "Peptidi"
Trovati 29699 prodotti di "Peptidi"
H-ILDTAGHEEY-OH
Peptide H-ILDTAGHEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C50H72N12O18Peso molecolare:1,147.19 g/molTyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Acetylated, Amide, Phosphorylated
Catalogue peptide; min. 95% purityFormula:C66H110N23O24PPeso molecolare:1,640.75 g/molH-LSEPAELTDAVK^-OH
Peptide H-LSEPAELTDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPVLKGVKL-OH
Peptide H-EPVLKGVKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C46H81N11O11Peso molecolare:982.22 g/molH-ERPPPVPNPDYEPIR^-OH
Peptide H-ERPPPVPNPDYEPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QPTESIVRF-OH
Peptide H-QPTESIVRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C48H75N13O14Peso molecolare:1,076.2 g/molH-Thr(tBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Thr(tBu)-2-ClTrt-Resin is an amine resin that is used as a building block for the synthesis of peptides. It is used in conjunction with other resins and chemicals to produce a wide variety of peptides. The resin contains 1% DVB, which improves the solubility and stability of the resin. This product can be used in a variety of applications, including peptide synthesis, protein sequencing, and antibody production.Purezza:Min. 95%Nesfatin-1 (Human)
Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.Formula:C427H691N113O134Purezza:Min. 95%Peso molecolare:9,551.95 g/molH-WEHR-OH
Peptide H-WEHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C28H36N10O6Peso molecolare:626.66 g/molFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,906.3 g/molAc-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMEDSTYYK^-OH
Peptide H-YMEDSTYYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CQHIMAILHYFEIVQ-OH
Peptide Ac-CQHIMAILHYFEIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STGGAPTFNVTVTK^-OH
Peptide H-STGGAPTFNVTVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAAGAFQGLR^-OH
Peptide H-VAAGAFQGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFESLK^-OH
Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H92N14O20SPeso molecolare:1,313.5 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GGRGGFGGRGGFGGRGGFG-NH2
Peptide Biot-GGRGGFGGRGGFGGRGGFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTDVQAWIR^-OH
Peptide H-GTDVQAWIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-LPPLLTDEM-OH
Peptide H-LPPLLTDEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C46H75N9O14SPeso molecolare:1,028.22 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SPeso molecolare:4,449.9 g/molH-SYPGLTSYLVR^-OH
Peptide H-SYPGLTSYLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPDAVATWLNPDPSQK^-OH
Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-XXXXXX-OH
Peptide Biot-XXXXXX-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSHSLTTNIMEILR^-OH
Peptide H-DSHSLTTNIMEILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLGTSNFK^-OH
Peptide H-AVLGTSNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 141
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,782.1 g/molgp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Abz-GIEPFSDPMPEQ-EDDnp
Peptide Abz-GIEPFSDPMPEQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYEPLEDPGVK^-OH
Peptide H-SYEPLEDPGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAGIGILTV^-OH
Peptide H-AAGIGILTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DEVDAFC-OH
Peptide Ac-DEVDAFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H2N-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-COOH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C31H55N11O9S1Peso molecolare:757.9 g/molH-MPRHSRAKRAPRPSAC-NH2
Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CEPLEKQHEKERKQEEGES
Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FR^-OH
Peptide H-FR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAELEHGSSAYSPPDAFK^-OH
Peptide H-VAELEHGSSAYSPPDAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VIGQGQQPSTAAR^-OH
Peptide H-VIGQGQQPSTAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSDPVWQVK^-OH
Peptide H-HSDPVWQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Proadrenomedullin (1-20) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C112H178N36O27Peso molecolare:2,460.87 g/molH-SFEMLILGR^-OH
Peptide H-SFEMLILGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEWVAR^-OH
Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FTITAGSK^-OH
Peptide H-FTITAGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDLLDK^-OH
Peptide H-ALDLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
