Peptidi

<p>Peptide H-E^V^D^P^I^G^HL^Y^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Lauric Acid-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ATNATLDPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GGMQIFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FL^HVTYVPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CMKKDDQIAAAIALRGMAKDGKFAVK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LQHLVNEL^THDIITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-L^EVFYNGAWGTV^GK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTSIQDWVQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Methyltetrazine-GLFDIIKKIAESF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSTLPAITLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide DOTA-LRELHLNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-TTAI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EQLSSVSSFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-ADEYLIPQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The BAD peptide is a synthetic fragment derived from the BAD protein (Bcl-2-associated death promoter), a pro-apoptotic member of the BH3-only family within the larger Bcl-2 family of proteins. The BAD peptide typically contains the BH3 domain of the BAD protein, which is crucial for its role in promoting apoptosis by interacting with anti-apoptotic proteins such as Bcl-2 and Bcl-xL. The BH3 domain of BAD, found in the BAD peptide, binds to anti-apoptotic proteins like Bcl-2 and Bcl-xL. Normally, these anti-apoptotic proteins protect the cell by preventing the activation of pro-apoptotic proteins like Bax and Bak, which are responsible for permeabilizing the mitochondrial outer membrane, a key step in apoptosis.When the BAD peptide binds to Bcl-2 or Bcl-xL, it inhibits their ability to prevent apoptosis. This disruption allows Bax and Bak to become activated, leading to mitochondrial outer membrane permeabilization (MOMP), release of cytochrome c, and activation of downstream caspases that execute cell death.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is a peptide that was originally isolated from the venom of the Brazilian spider, Phoneutria nigriventer. This peptide has been shown to have anti tumor activity in mice by targeting and binding to the tumor cells. H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is also a cell penetrating peptide (CPP) that can penetrate into the cell and disrupts cancer cell growth. It is also a disulfide rich peptide with RGD sequence which binds to integrins on the surface of tumor cells and induces apoptosis.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ASGQAFELILSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-FLPSDCFPSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YPEAPPSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-AIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GSLQKRGIV^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DIAPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Leu-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block for the synthesis of peptides. It may be used in the synthesis of amines, thiols, alcohols, and resin. This product can also be used as a tool for peptide synthesis.</p>

<p>H-ε-Aca-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block used in the synthesis of peptides. This resin has been designed to be compatible with amines, thiols, and alcohols, which are important for peptide synthesis. H-ε-Aca-2-ClTrt Resin (200-400 mesh) 1% DVB is an acid form of the amino acid Dde. It can be used for the preparation of solid phase peptide synthesis and for the purification of peptides after cleavage from the resin.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QL^DAYPSGAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GITNIN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Peptide H-IHWESASLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEYKLVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-VTSAPDTRPAPGSTAPPAHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-SIT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-EEPSLLKKLLLAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YGGFLRRIRPKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LGADMEDV^CGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DLGEENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>