Peptidi
Sottocategorie di "Peptidi"
Trovati 29634 prodotti di "Peptidi"
α-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formula:C52H74N20O15S4Peso molecolare:1,347.58 g/molRef: 3D-VAC-00405
Prodotto fuori produzionegp100 (178-187)
Catalogue peptide; min. 95% purity
Formula:C42H71N11O14S2Peso molecolare:1,018.23 g/molRef: 3D-VAC-00605
Prodotto fuori produzionebeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formula:C56H76N16O22Peso molecolare:1,325.32 g/molRef: 3D-VAC-00308
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C19H28N2O5Purezza:Min. 95%Peso molecolare:364.44 g/molRef: 3D-FI111494
Prodotto fuori produzionePKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PPeso molecolare:1,574.69 g/molRef: 3D-VAC-00448
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzioneRef: 3D-VAC-00256
Prodotto fuori produzioneTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Peso molecolare:1,667.90 g/molRef: 3D-VAC-00681
Prodotto fuori produzioneH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRef: 3D-FS108741
Prodotto fuori produzioneBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formula:C62H101N17O19Peso molecolare:1,388.58 g/mol[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formula:C175H272N54O59S6Peso molecolare:4,268.78 g/molRef: 3D-VAC-00243
Prodotto fuori produzioneParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SPeso molecolare:3,199.65 g/molRef: 3D-VAC-00276
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzioneInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Peso molecolare:894.04 g/molRef: 3D-VAC-00515
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purezza:Min. 95%Peso molecolare:878.85 g/molRef: 3D-VAC-00884
Prodotto fuori produzioneIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Purezza:Min 85% By Sds-Page.Somatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formula:C61H105N23O21SPeso molecolare:1,528.72 g/molRef: 3D-VAC-00704
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzione[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formula:C78H121N21O20Peso molecolare:1,673 g/molRef: 3D-VAC-00160
Prodotto fuori produzioneZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purezza:Min. 95%Peso molecolare:566.48 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Peso molecolare:2,342.56 g/molRef: 3D-VAC-00088
Prodotto fuori produzionerec IFN-gamma (human)
CAS:Prodotto controllatoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%GAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurezza:Min. 95%Peso molecolare:1,550.78 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
