Peptidi
Sottocategorie di "Peptidi"
Trovati 29788 prodotti di "Peptidi"
Ref: 3D-VAC-00385
Prodotto fuori produzioneTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Peso molecolare:1,667.90 g/molRef: 3D-VAC-00681
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formula:C86H151N31O26S2Peso molecolare:2,099.48 g/molRef: 3D-VAC-00226
Prodotto fuori produzioneAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formula:C61H94N18O16Peso molecolare:1,335.5 g/molRef: 3D-VAC-00247
Prodotto fuori produzioneCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SPeso molecolare:6,220.84 g/molRef: 3D-VAC-00238
Prodotto fuori produzione2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Peso molecolare:937.08 g/molRef: 3D-VAC-00048
Prodotto fuori produzioneBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Peso molecolare:2,342.56 g/molRef: 3D-VAC-00088
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H243N41O31Peso molecolare:3,080.83 g/molRef: 3D-VAC-00526
Prodotto fuori produzioneα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Peso molecolare:1,009.19 g/molRef: 3D-VAC-00246
Prodotto fuori produzioneNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formula:C53H84N12O16Peso molecolare:1,145.33 g/molRef: 3D-VAC-00891
Prodotto fuori produzionePKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PPeso molecolare:1,574.69 g/molRef: 3D-VAC-00448
Prodotto fuori produzioneAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formula:C165H261N51O55S2Purezza:Min. 95%Peso molecolare:3,903.28 g/molGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurezza:Min. 95%Peso molecolare:1,550.78 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C78H109N23O15SPeso molecolare:1,640.95 g/molRef: 3D-VAC-00562
Prodotto fuori produzione[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formula:C36H49N7O7SPeso molecolare:723.91 g/molRef: 3D-VAC-00172
Prodotto fuori produzioneLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formula:C42H66N12O12Peso molecolare:931.06 g/molRef: 3D-VAC-00201
Prodotto fuori produzioneRef: 3D-VAC-00524
Prodotto fuori produzioneTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formula:C51H91N19O18Peso molecolare:1,258.41 g/molRef: 3D-VAC-00735
Prodotto fuori produzioneAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molRef: 3D-VAC-00168
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formula:C81H128N32O19S2Peso molecolare:1,918.25 g/molRef: 3D-VAC-00039
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzione[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formula:C175H272N54O59S6Peso molecolare:4,268.78 g/molRef: 3D-VAC-00243
Prodotto fuori produzioneMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C101H172N30O32Peso molecolare:2,318.66 g/molRef: 3D-VAC-00546
Prodotto fuori produzioneRef: 3D-VAC-00213
Prodotto fuori produzioneBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molRef: 3D-VAC-00084
Prodotto fuori produzione[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Peso molecolare:1,541.73 g/molRef: 3D-VAC-00456
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
