
Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
H-Lys-Lys-Lys-Lys-Lys-OH
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C30H62N10O6Peso molecolare:658.89 g/molH-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CIANHTGVDIHRNGDFQKNG-NH2
Peptide Ac-CIANHTGVDIHRNGDFQKNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-EAIYAAPFAKKK-NH2
Peptide Ac-EAIYAAPFAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^L^IYWASTR^-OH
Peptide H-L^L^IYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^TSGSTSTSR^-OH
Peptide H-V^TSGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.a-Gliadin (229-246)
a-Gliadin (229-246) is derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th1-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.Peso molecolare:2,083.1 g/molH-PKRKAEGDAC-NH2
Peptide H-PKRKAEGDAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RRKDLHDDEEDEAMSITA-OH
Peptide Biot-RRKDLHDDEEDEAMSITA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IESVLSSSGK^-OH
Peptide H-IESVLSSSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Peptide pE-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^FYPSDIAVEWESNGQPESNYK^-OH
Peptide H-G^FYPSDIAVEWESNGQPESNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP-NH2
Peptide Ac-PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LREQLGPVTQEFWDNLEK^-OH
Peptide H-LREQLGPVTQEFWDNLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
UDP-β-L-Rhamnose
CAS:UDP-β-L-Rhamnose is a pentose sugar that is used as a research tool and an activator. It has been shown to be an inhibitor of ion channels and protein interactions, as well as a ligand for certain receptors. This compound has high purity and can be used in the study of cell biology, pharmacology, and immunology.
Formula:C15H24N2O16P2Purezza:Min. 95%Peso molecolare:550.3 g/molBID amide
BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID). Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.Colore e forma:PowderSH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C66H97N12O24PPeso molecolare:1,473.57 g/molMethacrylate-RGD-OH
Peptide Methacrylate-RGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Sapecin B
The peptide Sapecin B exhibits antimicrobial properties against gram-positive bacteria. It is originally derived from the sarcophaga peregrine embryonic cell line, NIH-Sape-4.Peso molecolare:1,094.8 g/molCyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQK^LVFFAEDVGSNK^GAIIGLMVG-OH
Peptide H-DAEFRHDSGYEVHHQK^LVFFAEDVGSNK^GAIIGLMVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 125
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,557.7 g/molLys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H24N4O6S1Peso molecolare:364.42 g/molH-WYEIEK^-OH
Peptide H-WYEIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFL^SKSLVF-OH
Peptide H-GFL^SKSLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-3 Agonist (Mouse)
Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-2 agonist peptide mimics the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.PAR-3 is required for intercellular adhesion molecule 1 (ICAM-1) expression in endothelial cells and PAR-3 cooperates with PAR-1 to mediate the effect of thrombin on cytokine production and vascular cell adhesion molecule (VCAM-) 1 expression.PAR activation has been linked to inflammation, therefore compounds that mimic or interfere with the PAR-activating processes are attractive therapeutic candidates.Peso molecolare:576.3 g/molHXB2 gag NO-86/aa341 - 355
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,497.7 g/molSIVmac239 - 52
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,765.9 g/molH-TPVITGAPYEYR^-OH
Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YVTSAPMPEPQAPGR^-OH
Peptide H-YVTSAPMPEPQAPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATADDELSFK^-OH
Peptide H-ATADDELSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAEIAR^-OH
Peptide H-LQDAEIAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MART-1 (26-35) (human)
CAS:Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Formula:C42H74N10O14Peso molecolare:943.11 g/molH-ELTIGSK^-OH
Peptide H-ELTIGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bim BH3, Peptide IV
A 26-residue fragment from BH3 only protein Bim, BH3 only proteins constitute a major proportion of pro-apoptotic members of the B-cell lymphoma 2 (Bcl-2) family of apoptotic regulatory proteins and participate in embryonic development, tissue homeostasis and immunity.Colore e forma:PowderPeso molecolare:3,267.6 g/mol[5-FAM]-PR9
CPPs can transport molecules such as nucleic acids, proteins and imaging agents into cells of inter-est. PR9, Pas non-arginine, is an arginine rich CPP. It is composed of the nona-arginine: R9 and Pas which is a peptide penetrating accelerating sequence and it functions to export molecules out of endocytic vesicles. During a study in which PR9 was in complex with a Quantum dot probe (QD) it was evident that the PR9/QD complex was transported into the cell through endocytosis where it co-localises with actins, lysosomes, early endosomes and the nucleus. Due to the non-toxicity of the PR9/QD complex it can be used as a safe vector for biomedical purposes.It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Peso molecolare:2,584.01 g/molGly-Thr-Trp-Tyr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C26H31N5O7Peso molecolare:525.55 g/molAntennapedia peptide amide
Penetratin is a cell-penetrating peptide (CPP), also known as a protein transduction domain (PTD), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain. Penetratin linked to a phosphodiester oligonucleotide is capable of permeating through neuronal cell membranes and down-regulating genes.Peso molecolare:2,245.75 g/molProlactin-releasing peptide (PrRP20)
Prolactin-releasing peptide (PrRP20) was originally identified for being able to stimulate lactin release. However, that is not considered its function anymore, it is reclassified as a neuropeptide with a role in energy balance, and an inhibitor of appetite. PrRP20 is considered a central neuromodulator found within the A1 and A2 noradrenergic neurons and neurons of the dorsomedial nucleus of the hypothalamus. PrRP20 binds with high affinity to the G protein coupled receptor GPR10. Binding can lead to activation of numerous signalling pathways including activation of mitogen-activated protein kinase/extracellular-regulated kinase (MAPK/ERK1/2) and cAMP response element-binding protein (CREB). Not much is known about the binding mechanism and activation of GPR10. Use of PrRP20 and its analogs have aimed to provide greater insight to the binding and activation of GRP10 to better understand how this effects energy balance. With new links being made between diabetes and obesity with Alzheimer's disease it raises the question of whether PrRP20 and GP10 may be a factor in the disease development due to the colocalization in the same brain regions. Further study may lead to novel therapies for obesity, diabetes, and Alzheimer's disease in the future.Peso molecolare:2,271.2 g/molHIV - 1 MN ENV - 137
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,667 g/molHXB2 gag NO-99/aa393 - 407
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,663.9 g/molH-LKEFGNTLEDK^-OH
Peptide H-LKEFGNTLEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAHTVVTSR^-OH
Peptide H-FAHTVVTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GP120 - W61D - 57
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,621.9 g/molSemaglutide Heavy
Semaglutide is a glucagon-like peptide-1 receptor agonist (GLP-1 RA). It mimics the GLP-1 hormone, released in the gut in response to eating. Semaglutide can enhance insulin secretion and suppress glucagon section in a glucose-dependent manner. It also increases gastric emptying time and reduces intestinal motility. This combination leads to a decrease in appetite. Semaglutide has a long half-life allowing weekly subcutaneous application. Semaglutide also has positive effects on heart, liver, and lung function. Semalgutide also slows the progression of the effects of Alzheimer’s disease. This is a heavy isotype-labelled version of semaglutide that is suited to peptide quantification by mass spectrometry. This allows it to be used as an internal standard for quantification of semaglutide. There are two phenylalanine residues isotopically labelled with carbon-13 (9) and nitrogen-15 (1); one valine is labelled with carbon-13 (5) and nitrogen-15 (1); two leucine residues labelled with carbon-13 (6) and nitrogen-15 (1). This semaglutide peptide has a mass increase of 40 compared to the unlabelled peptide.25nmol = 0.1mgFormula:C35C152H291N5N40O59Colore e forma:PowderPeso molecolare:4,151.2 g/molH-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
