Peptidi
Sottocategorie di "Peptidi"
Trovati 29613 prodotti di "Peptidi"
Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is a peptide resin that is used in the solid phase synthesis of peptides and small molecules. This product has been shown to be an effective inhibitor for Ion channels, Receptor, Ligand, and even Cell Biology. It is also a high purity reagent that can be used in a variety of applications including Pharmacology and Protein interactions. The Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is available for purchase with CAS No. 680904-06-4.Purezza:Min. 95%Ac-RKRR-NH2
Peptide Ac-RKRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2
H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 is a peptide that is involved in tumor targeting. This peptide binds to the integrin αvβ3, which is expressed at high levels on the surface of tumor cells and plays an important role in tumor progression. It has been shown to be able to induce apoptosis in cancer cells and inhibit angiogenesis by binding to the RGD motif on integrins. H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 also inhibits cell proliferation and induces cell cycle arrest.Formula:C35H58N16O13S2Purezza:Min. 95%Peso molecolare:975.08 g/molAc-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leuprolide Human
Leuprolide is a synthetic hormone that is used for the treatment of prostate cancer. It works by blocking the production of hormones called luteinizing hormone and follicle-stimulating hormone in the body. Leuprolide is also used to treat endometriosis, uterine fibroids, and early puberty. This drug has been shown to have an inhibitory effect on prostate cancer cells in vitro and in vivo.Formula:C59H84N16O12Purezza:Min. 95%Peso molecolare:1208.64546H-LFDSDPITVTVPVEVSR^-OH
Peptide H-LFDSDPITVTVPVEVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu(Met-OH)-OH
CAS:H-Glu(Met-OH)-OH is an enzyme that catalyzes the conversion of stachyose to sucrose. It is also a synthetase that catalyzes the formation of fatty acids. H-Glu(Met-OH)-OH has been shown to be active in cancer cells and may be used as a potential therapeutic target for cancer treatment. This enzyme is inhibited by sodium hydroxide solution, hydrochloric acid, and urea nitrogen. The activity of H-Glu(Met-OH)-OH is measured by its ability to synthesize fatty acids from glucose in the presence of ATP and NADPH. Hydroxide solution can also be used to measure the activity of H-Glu(Met-OH)-OH as it converts stachyose to sucrose in the presence of ATP, NADP+, and sodium hydroxide solution. The rate at which this reaction occurs can be measured using a spectrophotometer with a carboxylate absorbFormula:C10H18N2O5SPurezza:Min. 95%Colore e forma:SolidPeso molecolare:278.33 g/molPhytosulfokine-α
CAS:Phytosulfokine (PSK) was introduced in 1996 by Matsubayashi and Sakagami of Nagoya University. It is the world's first peptide phytohormone to be isolated from asparagus culture medium. Tyr undergoes post-translational sulfation modification, which is essential for bioactivity. As an example of oxidative peptides showing bioactivity, in animals, CCK-octapeptide (26-33) (sulfated form), PCK-4100-V, CCK-33 (Human), PCK-4201-S and CCK-33 (Porcine), PCK-4176-S are known, but they were first found in plants. The functions of phytosulfokine are i) plant cell proliferation and differentiation activity acting at nanomolar concentrations ii) chlorophyll synthesis-promoting activityiii) formation of adventitious roots and buds iv) adventitious embryogenesisv) involvement in disease resistance The active expression of these PSKs is accompanied by membrane-bound LRR receptors, which are PSK receptors. Leucine-rich repeat receptor-like kinase is involved.
Formula:C33H46N6O16S2Purezza:Min. 95%Peso molecolare:846.88 g/molSIVmac239 - 45
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,697.9 g/molH-DLATVYVDVLK^-OH
Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H79N11O14S2Peso molecolare:1,050.31 g/molAc-CELNSQLLTQENRLS-OH
Peptide Ac-CELNSQLLTQENRLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,714 g/molSuc-KRRK-NH2
Peptide Suc-KRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHITSLLPTPEDNLEIVLHR^-OH
Peptide H-VHITSLLPTPEDNLEIVLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MVLQNSGKFRAESRGDC-NH2
Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDNLAR^-OH
Peptide H-ALDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Amyloid beta peptide(1-40) trifluoroxalate - synthetic
CAS:Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serumFormula:C194H295N53O58S·C2HF3O2Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:4,443.83 g/molSIVmac239 - 82
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,569.9 g/molHepcidin-9 (Mouse)
Hepidin-9 (mouse), a trifluoroacetate Salt product, is a variant of the peptide hormone hepcidin-25 that is produced in mice. Hepcidin plays a critical role in regulating iron metabolism in the body by controlling the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. In mice, hepcidin is primarily produced in the liver, and its expression is regulated by a variety of factors, including iron status, inflammation, and erythropoietic signals. Hepcidin has been found to play a critical role in the development of iron-related disorders in mice, including anemia and iron overload. The study of Hepcidin-9 can provided important insights into the regulation of iron metabolism in mammals and may help to inform the development of treatments for iron-related disorders in humans.Formula:C50H73N11O13SPurezza:Min. 95%Peso molecolare:1,068.27 g/molH-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH
Peptide H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYQAVTTTL-OH
Peptide H-KYQAVTTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSTLPAITLK^-OH
Peptide H-VSTLPAITLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Diethylcyanomethylphosphonate
CAS:Diethylcyanomethylphosphonate is a hydrochloric acid salt of diethylcyanomethylphosphonic acid. It is used in the asymmetric synthesis of many organic molecules, including pharmaceuticals, and has been shown to have antiviral properties. Diethylcyanomethylphosphonate binds to the receptor on the surface of cells and inhibits their growth. This may be due to its ability to block the binding of sodium ions to cell receptors. The drug also prevents hydroxyl group metabolism and has been shown to be active against infectious diseases such as HIV and malaria.
Formula:C6H12NO3PPurezza:Min. 95%Colore e forma:Colorless Clear LiquidPeso molecolare:177.14 g/molH-SVAVSQVAR^-OH
Peptide H-SVAVSQVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVL^DSDGSF^FLYSR-OH
Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 43 (TRQQNQWKEPDVYYT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,956.1 g/molH-Met-Gly-Pro-AMC·HCl
CAS:H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.Formula:C22H28N4O5S·HClPurezza:Min. 97 Area-%Colore e forma:PowderPeso molecolare:497.01 g/molBombinin-Like Peptide (BLP-1)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C115H194N34O33Peso molecolare:2,581.04 g/molBiotinylated TAT (47-57)
Biotinylated Tat Peptide available in the trifluroacetate salt form. TAT(Transactivated-transcripiton) Peptide Derived from the HIV TAT Protein, is a Cell-Penetrating Peptide which has the ability to transport itself across cell membranes independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics.Formula:C74H132N34O16SPurezza:Min. 95%Peso molecolare:1,786.16 g/molHLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,093.3 g/molANP (Rat, 1-28)
ANP (Rat, 1-28) is a peptide that is the active fragment of atrial natriuretic peptide. It has been shown to activate ion channels and inhibit protein interactions. ANP (Rat, 1-28) has also been used as a research tool for studies on receptor biology and pharmacology.
Purezza:Min. 95%Fmoc-Acc-Resin
Fmoc-ACC-Resin is a resin for the synthesis of peptides that has been used for the synthesis of Fmoc-protected amino acids and peptides. The resin is a solid support that can be used in automated peptide synthesizers. It can be used in the synthesis of peptides with N-terminal amine or carboxylic acid groups, such as Fmoc-amino acids, Fmoc-NHS esters, and side chain protected amino acids.Purezza:Min. 95%CMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,632.8 g/molCMVpp65 - 127 (GQNLKYQEFFWDAND)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,875 g/molH-FRKKWNKWALSR-NH2
Peptide H-FRKKWNKWALSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTLLAPLNSVFK^-OH
Peptide H-LTLLAPLNSVFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSKGR^-OH
Peptide H-SSKGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AILNYIASK^-OH
Peptide H-AILNYIASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-YGGFM-OH
Peptide Fluor-YGGFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANIKLSVQMKLFKRHLKWKIIVKLNDGRELSLD-NH2
Peptide H-ANIKLSVQMKLFKRHLKWKIIVKLNDGRELSLD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPALHFLGGGSC-NH2
Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,771 g/molH-NIYLNSGLTSTK^-OH
Peptide H-NIYLNSGLTSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3762-PI.webp&w=3840&q=75)
