Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30471 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-ELNNN-NH2
<p>Peptide Ac-ELNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 24 (NVHNPTGRSICPSQE)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,638.8 g/mol(Pro-Pro-Gly)5 • 4 H2O
<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>Formula:C60H87N15O16•4H2OPurezza:Min. 95%Peso molecolare:1,346.46 g/molH-IANVFTNAFR^-OH
<p>Peptide H-IANVFTNAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CGVNNSNEDFREENLKTAN-NH2
<p>Peptide Ac-CGVNNSNEDFREENLKTAN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAVSYQTK^-OH
<p>Peptide H-IAVSYQTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Teduglutide
CAS:<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>Formula:C164H252N44O55SPurezza:Min. 95%Peso molecolare:3,752.16 g/molH-GSESGIFTNTK^-OH
<p>Peptide H-GSESGIFTNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H2N-Gln-Asp-Gly-Asn-Glu-Glu-Met-Gly-Gly-Ile-Thr-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C124H204N32O46S2Peso molecolare:2,943.26 g/molH-FTLSVDR-OH
<p>Peptide H-FTLSVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C37H60N10O12Peso molecolare:836.93 g/molMBP MAPK Substrate
<p>Peptide MBP MAPK Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C39H70N18O11Peso molecolare:967.11 g/molAc-MRTPRCGVPDLGR-NH2
<p>Peptide Ac-MRTPRCGVPDLGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGDVFVVPR^-OH
<p>Peptide H-QGDVFVVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-2Kd Mouse MAGE-A3 SYVKVLHHM
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>[D-Trp34]-Neuropeptide Y, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C195H287N55O56SPeso molecolare:4,329.8 g/molFormyl-MEFVAKLFKFFKDLLGKFLGNN-OH
<p>Peptide Formyl-MEFVAKLFKFFKDLLGKFLGNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNSLSELEVK^-OH
<p>Peptide H-NLNSLSELEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>13C-PT630
<p>Peptide 13C-PT630 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LEAP-2 (38 - 77) (Human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C191H320N64O57S5Peso molecolare:4,585.36 g/molH-YGGFLRR^I-OH
<p>Peptide H-YGGFLRR^I-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2
<p>Peptide Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSRSRSPPKRWSTIF-NH2
<p>Peptide H-CSRSRSPPKRWSTIF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TQIDQVESTAASLQAQWR^-OH
<p>Peptide H-TQIDQVESTAASLQAQWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyc-Ac-CVRGDFC-NH2
<p>Peptide Cyc-Ac-CVRGDFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDYGSLSGR^-OH
<p>Peptide H-VGDYGSLSGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 envelope - 85
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:2,160.4 g/molAc-PPGAEGNRTAGPPRRNEALAR-NH2
<p>Peptide Ac-PPGAEGNRTAGPPRRNEALAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-GPGPGPGPGPGPGPGPGPGP-OH
<p>Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-Trp(CHO)-OH
CAS:<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>Formula:C17H20N2O5Purezza:Min. 95%Peso molecolare:332.35 g/molAc-CIANHTGVDIHRNGDFQKNG-NH2
<p>Peptide Ac-CIANHTGVDIHRNGDFQKNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSALGFLR^-OH
<p>Peptide H-DSALGFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-L^L^IYWASTR^-OH
<p>Peptide H-L^L^IYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALHFAISEYNK^-OH
<p>Peptide H-ALHFAISEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVSPDPSTTGAASPASSSAGGSAAR^-OH
<p>Peptide H-EVSPDPSTTGAASPASSSAGGSAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYLILEYAPLGTVYR^-OH
<p>Peptide H-VYLILEYAPLGTVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CART (Human, 55-102)
CAS:<p>CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.</p>Formula:C225H365N65O65S7Purezza:Min. 95%Peso molecolare:5,245.2 g/molH-MKNPKKKSGGFRIVC-NH2
<p>Peptide H-MKNPKKKSGGFRIVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPPGFSPFR^-OH
<p>Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FSFKGIKFSKGKYK-NH2
<p>Peptide Ac-FSFKGIKFSKGKYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMRNALVRF-NH2
<p>Peptide H-AMRNALVRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PACAP-27 (human, mouse, ovine, porcine, rat)
CAS:<p>PACAP 1-27 (Pituitary adenylate cyclase-activating polypeptide 27) is a potent stimulator of adenylyl cyclase and increases cAMP levels.</p>Formula:C142H224N40O39SPeso molecolare:3,147.65 g/molH-TL^SDYNIQK^-OH
<p>Peptide H-TL^SDYNIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lactacystin
CAS:<p>Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.</p>Formula:C15H24N2O7SPurezza:Min. 95%Peso molecolare:376.43 g/molAc-ASHLGLAR-OH
<p>Peptide Ac-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C186H275N51O59Peso molecolare:4,169.54 g/molH-SSANYR^-OH
<p>Peptide H-SSANYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-98
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,663 g/molHXB2 gag NO-106
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,778 g/molBoc-D-Glu(OBzl)-OH
CAS:<p>Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.</p>Formula:C17H23NO6Purezza:Min. 95%Peso molecolare:337.37 g/molLCBiot-YGGFLRRQFKVVT-OH
<p>Peptide LCBiot-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![[D-Trp34]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50494.webp&w=3840&q=75)
