Peptidi

<p>Peptide H-MVTAVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H1 is the linker histone and is important for chromatin condensation, it binds to the nucleosomal core particles and protects the free linker DNA (ˆ¼20 bp) between each nucleosome. H1 can fine-tune transcription in a locus-specific manner. H1 is involved in several processes, its interaction partners include: pre-mRNA splicing factors- histone chaperones- components of the transcription machinery and DNA-damage response factors. There a 12 subtypes of the H1 linker histone, and they are thought to have specific functions, making H1 the most divergent histone protein family. Like other histones, H1's are extensively post-translationally modified with modifications including: methylation, acetylation, ubiquitination, formylation, poly-ADP ribosylation and phosphorylation.Changes in H1 composition and expression levels are seen in several cancers and other diseases.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-QVQLQQPGAELVKPGASVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EGVVGAVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fluorescently labelled substrate for the severe acute respiratory syndrome coronavirus main protease (SARS-CoV Mpro). The substrate sequence is derived from residues P4-P5' of the SARS-CoV Mpro N-terminal autoprocessing site which has the sequence AVLQSGFRK. SARS-CoV Mpro is a key antiviral target.This peptide contains an N-terminal a 5-carboxytetramethylrhodamine (5-TAMRA), a widely used fluorescent dye which excites at 546 nm and emits at 579 nm and a black hole quencher 2 (BHQ-2) group. This Mpro substrate is used in Mpro inhibition assays. The compound being tested for its inhibitory capacity of Mpro is added alongside [5-TAMRA]/[Lys(BHQ-2)]-CoV, after a set time period, the amount of fluorescence released is read as a percentage inhibition by a plate reader.The fluorescence from 5-TAMRA is efficiently quenched by resonance energy transfer to the BHQ-2 group when the peptide is intact, however upon cleavage of the peptide by Mpro, 5-TAMRA and BHQ-2 are separated, allowing fluorescence to be detected. This therefore represents a useful tool for investigating Mpro activity.</p>

<p>Cathelicidin-related anti-microbial peptide (CRAMP) is the mouse homologue of the human LL-37 anti-microbial peptide. CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity. CRAMP is encoded for by the Cramp gene which is highly expressed in bone marrow and up-regulated by infectious and inflammatory signals, CRAMP is secreted by cells such as neutrophils epithelial cells and macrophages. This peptide represents the mature, extended, form of CRAMP, longer than the 34 amino acid peptide originally isolated from the bone marrow of mice. CRAMP (1-39) has enhanced anti-microbial activity compared to CRAMP (6-39).</p>

<p>Peptide Ac-LEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Portion of EBV</p>

<p>Neurokinin B (NKB) is a member of the tachykinin family of peptides that include substance P (SP), neurokinin A (NKA), endokinins and haemokinins. NKB is encoded by TAC3 in humans and Tac2 in rodents and along with the neuropeptide kisspeptin plays an essential role as gatekeeper of puberty.NKB plays a stimulatory role in luteinising hormone (LH) release in a number of species, likely mediated via the secretion of gonadotropin-releasing hormone (GnRH) in a kisspeptin-dependent manner (NKB appears to play a critical role in the control of kisspeptin release). NKB may contribute to the regulation of reproductive functions by metabolic cues. NKB binds with highest affinity to the G-protein coupled neurokinin-3 receptor NK3R also known as tachykinin receptor 3 (TACR3)</p>

<p>H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.</p>

<p>Amino acids 6-39 of the cathelicidin-related anti-microbial peptide (CRAMP), the mouse homologue of the human LL-37 anti-microbial peptide.CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity.CRAMP is a cationic peptide, encoded for by the Camp gene and is highly expressed in bone marrow. Its expression is up-regulated by infectious and inflammatory signals and it is secreted by cells such as neutrophils epithelial cells and macrophages.This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used, green fluorescent tag</p>

Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-RAHEEIYHFFFAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FL^DEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Leptin is a member of the adipocytokines or adipokines group of cytokines which are primarily produced in adipose tissue. Leptin is both a hormone involved in multiple endocrine functions, bone metabolism and thermoregulation, and a cytokine that promotes inflammatory responses. People with obesity have elevated levels of leptin. This contributes to the state of low-grade inflammation that makes those individuals more likely to develop cardiovascular diseases, type II diabetes, degenerative disease and autoimmune disease. Reduced levels of leptin, found in malnourished individuals, has been linked to an increased risk of infection and reduced cell-mediated immunity.Leptin binds to leptin receptors (ObRs), of which there are at least six isoforms (ObRa, ObRb, ObRc, ObRd, ObRe, and ObRf). This fragment of leptin has been shown to restrict weight gain and food intake in female mice lacking active leptin.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SASFNTDPYVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The pathology of coronary heart disease (CHD) and ischemia are linked to the health of endothelial cells in the heart.- However, providing molecular therapies specifically into myocardium remains elusive. The cardiac targeting peptide (CTP) was shown to specifically transduce cardiomyocytes as it is a cationic PTD.This peptide can be used as a conjugate to deliver molecules specifically to the heart. This can be a crucial tool for research into therapeutic drug delivery for ischemic attacks and infarctions. This peptide is research quality and therefore for research purposes only, and not for use in a therapeutic setting.</p>

<p>Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-DQFPEVYVPTVFENYVADIEVDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Abz-QPMAVVQSVPQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NPANNAAIVLQLPQGTTLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YLQPR^TFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Kallikrein-2 inhibitor</p>

Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide LCBiot-PVVAESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TISVIPGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SVTEQGAELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NANAEPAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MSKQQPTQFINPETPGYVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RRRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>