
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30315 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
(Ala1)-PAR-4 (1-6) amide (mouse)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C34H48N8O7Peso molecolare:680.8 g/molH2N-Gln-Asp-Gly-Asn-Glu-Glu-Met-Gly-Gly-Ile-Thr-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C124H204N32O46S2Peso molecolare:2,943.26 g/mol5Fam-GPGPGPGPGPGPGPGPGPGP-OH
<p>Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEQEQPL^GQWHL^S-OH
<p>Peptide H-NEQEQPL^GQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGLSTGWTQLSK^-OH
Peptide H-SGLSTGWTQLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TASSYFTNMFATWSPSKARL-NH2
<p>Peptide H-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2
Peptide H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LL-37 amide
CAS:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.Formula:C205H341N61O52Peso molecolare:4,493.3 g/molH-RPPGFSPFR^-OH
Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-98
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,663 g/molH-IGQLEEQLEQEAK^-OH
<p>Peptide H-IGQLEEQLEQEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPGFFSPMLGEFVSETESR^-OH
<p>Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GQVGRQLAIIGDDINR-NH2
Peptide Ac-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLEDVFSK^-OH
<p>Peptide H-HLEDVFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chorionic Gonadotropin-β (109-145) (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C167H264N46O58S1Peso molecolare:3,876.27 g/molH-LLVVYPWTQR^^-OH
<p>Peptide H-LLVVYPWTQR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STSGGTAALGCL^VK-OH
<p>Peptide H-STSGGTAALGCL^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYSMEHF^RWGKPV-NH2
<p>Peptide H-SYSMEHF^RWGKPV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CSHRKSLPKAD-OH
<p>Peptide Ac-CSHRKSLPKAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Max-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C107H201N29O21Peso molecolare:2,230 g/molLauryl-AYSSGAPPMPPF-OH
<p>Peptide Lauryl-AYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 108 (ASTSAGRKRKSASSA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,464.6 g/molPhe-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C19H29N3O5Peso molecolare:379.45 g/molH-ALLAFQESK^-OH
<p>Peptide H-ALLAFQESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
<p>Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH
<p>Peptide LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPEPCHPK^-OH
<p>Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Acetyl-TGF-beta 2-LAPbeta (259- 269)
<p>Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.</p>Colore e forma:PowderPeso molecolare:1,267.6 g/molH-SHFANLK^-OH
<p>Peptide H-SHFANLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TNYLTHR^-OH
<p>Peptide H-TNYLTHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ile-Val-Ile
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C17H33N3O4Peso molecolare:343.46 g/molACTH (1-13), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C75H106N20O19SPeso molecolare:1,623.9 g/molAc-LEGR-OH
<p>Peptide Ac-LEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIEIETQVPEK^-OH
<p>Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHVDPENFR^-OH
<p>Peptide H-LHVDPENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAQLEEQLDNETK^-OH
<p>Peptide H-IAQLEEQLDNETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2
<p>Peptide Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FMRF-like neuropeptide flp-4-2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C44H66N12O10Peso molecolare:923 g/molH-ATGIPDR^-OH
Peptide H-ATGIPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSQYIEWLQK^-OH
<p>Peptide H-VSQYIEWLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPSDFFPSV^-OH
<p>Peptide H-FLPSDFFPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Suc-Ala-Val-Pro-Phe-pNA
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C32H40N6O9Peso molecolare:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
<p>Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MYNPTNILDVK^-OH
<p>Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
