
Peptidi
Sottocategorie di "Peptidi"
Trovati 29887 prodotti di "Peptidi"
HIV - 1 MN ENV - 143
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,696.1 g/molH-YDPSLKPLSVSYDQATSLR^-OH
Peptide H-YDPSLKPLSVSYDQATSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SQNYPIVQ-OH
Peptide Ac-SQNYPIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQAEEELIK^-OH
Peptide H-NQAEEELIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARTKQTARKSTGGKA-NH2
Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YNGLVTGTR^-OH
Peptide H-YNGLVTGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SLV-NH2
Peptide Ac-SLV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DDTSRMEEVD-OH
Peptide Ac-DDTSRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-APEEIMRRQ-EDDnp
Peptide Abz-APEEIMRRQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-DPIYALSWSGMA-OH
Peptide 5TAMRA-DPIYALSWSGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^IFDANAPVAVR^-OH
Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.26Rfa, Hypothalamic Peptide, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C127H195N37O37Peso molecolare:2,832.17 g/molFmoc-Trp(Boc)-Rink-Amide MBHA Resin
Please enquire for more information about Fmoc-Trp(Boc)-Rink-Amide MBHA Resin including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ac-DHLASLWWGTEL-NH2
Peptide Ac-DHLASLWWGTEL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β-Amyloid (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C194H295N53O58S1Peso molecolare:4,329.86 g/molH-GQNDTSQTSSPS-Phosphocolamine
Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFALWSAVTPLTFTR^-OH
Peptide H-AFALWSAVTPLTFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 53
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molPLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SPeso molecolare:1,583.8 g/molH-SSDTEENVK^-OH
Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARV^YIHPF-OH
Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TentaGel® R RAM Resin (90 um), Rink-type
TentaGel® R RAM Resin (90 um), Rink-type can be used for the preparation of peptide amides (Rink-type) (90 µm) 018-022 meq/g and is specially designed for difficult and long sequences.
TentaGel, is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix.Purezza:Min. 95%H-GLNEEIAR^V-OH
Peptide H-GLNEEIAR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^V^GGLVALR^-OH
Peptide H-V^V^GGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAVVRTPPK^-OH
Peptide H-VAVVRTPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B-Ahx-APRTPGGRR-NH2
Peptide B-Ahx-APRTPGGRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGMEVTPSGTWLTYTGAIK^-OH
Peptide H-IGMEVTPSGTWLTYTGAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C58H94N16O14Peso molecolare:1,239.47 g/molKISS (107-121)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C88H124N24O22Peso molecolare:1,869.1 g/molAc-GEGQQHHLGGAKQAGDV-OH
Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIITFEKL-OH
Peptide H-SIITFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-EDIIRNIARHLAQVGDSMDR-OH
Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPVSVGVDAR^-OH
Peptide H-GPVSVGVDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FG-OH
Peptide Ac-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Chorionic Gonadotropin Human
Human chorionic gonadotropin (hCG) is a peptide hormone produced in pregnancy, that is made by the embryo soon after conception and later by the part of the placenta. Its role is to prevent the disintegration of the corpus luteum of the ovary and thereby maintain progesterone production that is critical for a pregnancy in humans. hCG may have additional functions, for instance it is thought that it affects the immune tolerance of the pregnancy. Early pregnancy testing generally is based on the detection or measurement of hCG.Purezza:Min. 95%PrEST Antigen TAS2R39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:21 g/molAc-VLQWAEKGYYTMSNN-NH2
Peptide Ac-VLQWAEKGYYTMSNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTFSNIK^-OH
Peptide H-VTFSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STQSAIDQI^TGK-OH
Peptide H-STQSAIDQI^TGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSSPAVITDK^-OH
Peptide H-LSSPAVITDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anti-Flt1 Peptide
Peptide Anti-Flt1 Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C37H49N9O9Peso molecolare:763.86 g/molAc-DWSSWVYRDPQT-NH2
Peptide Ac-DWSSWVYRDPQT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molAngiotensin I (1-9)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H78N16O13Peso molecolare:1,183.35 g/molAc-WEDWVGWI-NH2
Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-KFEEERARAKWDT-OH
Peptide Myr-KFEEERARAKWDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
