Peptidi
Sottocategorie di "Peptidi"
Trovati 29610 prodotti di "Peptidi"
H-NFNTVPYIVGINK-OH
Peptide H-NFNTVPYIVGINK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIGQGQQPSTAAR-OH
Peptide H-VIGQGQQPSTAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide H-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITNDR-OH
Peptide H-TITNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEGLQEALLK-OH
Peptide H-TEGLQEALLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFYPSDIAVEWESNGQPEDNYK-OH
Peptide H-GFYPSDIAVEWESNGQPEDNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLTEVETPIRNEWGSRSNDSSD-OH
Peptide H-SLLTEVETPIRNEWGSRSNDSSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQYCYELDEK-OH
Peptide H-GQYCYELDEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSHVLYSIAFED-OH
Peptide H-LSHVLYSIAFED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NILTSNNIDVK-OH
Peptide H-NILTSNNIDVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CKKKKKKC-OH
Peptide H-CKKKKKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGLQLSQDPTGR-OH
Peptide H-TGLQLSQDPTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPASNLGLEDIIRKALMGSFDDK-OH
Peptide H-DPASNLGLEDIIRKALMGSFDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDSILAVR-OH
Peptide H-EDSILAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AQ-OH
Peptide H-AQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRQPPRSISSHP-OH
Peptide H-RRQPPRSISSHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SWMESEFRVY-OH
Peptide H-SWMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYKDHDGDYKDHDIDYKDDDDK-OH
H-DYKDHDGDYKDHDIDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-DSLFIPIR-OH
Peptide H-DSLFIPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYKDDDDKDYKDDDDKDYKDDDDK-OH
H-DYKDDDDKDYKDDDDKDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AVDLSHFLK-OH
Peptide H-AVDLSHFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH
H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C211H318N62O59S3Peso molecolare:4,763.42 g/molH-VSEHFSLLF-OH
Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIANFKIEPPGLFRGRGNHP-OH
Peptide H-RIANFKIEPPGLFRGRGNHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVINGNPITIFQER-OH
Peptide H-LVINGNPITIFQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LYATVIHDI-OH
H-LYATVIHDI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-LFDQAFGVPR-OH
Peptide H-LFDQAFGVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EITPEKNPQ-OH
Peptide H-EITPEKNPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKKKKKK-OH
Peptide H-KKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSDQIHFFFAK-OH
Peptide H-TSDQIHFFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSTLGLDIETATR-OH
H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-INWLKLGKMVIDAL-OH
H-INWLKLGKMVIDAL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C76H129N19O17SPeso molecolare:1,613.04 g/molH-AFLLTPR-OH
Peptide H-AFLLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-3-(2-furyl)-D-alanine
CAS:Formula:C22H19NO5Purezza:>98.0%(T)(HPLC)Colore e forma:White to Orange to Green powder to crystalPeso molecolare:377.40H-FSKKDKPLCKKHAHSVNF-OH
Peptide H-FSKKDKPLCKKHAHSVNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KTCPVQLWV-OH
Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVSIWNLDY-OH
Peptide H-KVSIWNLDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TIDYFQPNNK-OH
Peptide H-TIDYFQPNNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PFAV-OH
Peptide H-PFAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPVSDR-OH
Peptide H-TPVSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDEVTYLEASK-OH
Peptide H-LLDEVTYLEASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFVYIPLFL-OH
Peptide H-IFVYIPLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPASELLKYLTT-OH
Peptide H-RPASELLKYLTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IHSMNSTIL-OH
Peptide H-IHSMNSTIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RMIAISAKV-OH
Peptide H-RMIAISAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLLDGLRAQ-OH
Peptide H-YLLDGLRAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YEVLTPLKWYQNM-OH
Peptide H-YEVLTPLKWYQNM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR-OH
Peptide H-YTPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPQKRPSCI-OH
Peptide H-RPQKRPSCI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-3-(2-furyl)-D-alanine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FF0934.webp&w=3840&q=75)
