Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 29603 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-FLGGPPVCL-OH
Peptide H-FLGGPPVCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RVPPRYHAKISPMVN-OH
Peptide H-RVPPRYHAKISPMVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QNGALAINTF-OH
Peptide H-QNGALAINTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALEIA-OH
Peptide H-ALEIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YYYYYY-OH
Peptide H-YYYYYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C54H56N6O13Peso molecolare:997.1 g/molH-GNDVAFHFNPR-OH
Peptide H-GNDVAFHFNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EADPIGHLY-OH
H-EADPIGHLY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EDLAALEK-OH
Peptide H-EDLAALEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YILEETSVM-OH
Peptide H-YILEETSVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTSQMHTASSLEK-OH
Peptide H-ESTSQMHTASSLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EECDSELEIKRY-OH
Peptide H-EECDSELEIKRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAA-OH
Peptide H-AAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GCGKKKK-OH
Peptide H-GCGKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDELLQSQIEK-OH
Peptide H-LDELLQSQIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVK-OH
Please enquire for more information about H-KVK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:Min. 95%H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Peptide H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C258H401N79O78Peso molecolare:5,857.5 g/molH-QIFNKPYWL-OH
Peptide H-QIFNKPYWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GCRDVPMSMRGGDRCG-OH
Peptide H-GCRDVPMSMRGGDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HCLGKWLGHPDKF-OH
Peptide H-HCLGKWLGHPDKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H- KAFSPEVI-OH
Peptide H- KAFSPEVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPQGFSAL-OH
Peptide H-DLPQGFSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITIRPR-OH
Peptide H-LSITIRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTSCVNPPTVQNAHILSR-OH
Peptide H-STDTSCVNPPTVQNAHILSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPGAAGYDL-OH
Peptide H-SPGAAGYDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VADPDHDHTGFLTEYVATR-OH
Peptide H-VADPDHDHTGFLTEYVATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSLAQEQVGGSPEK-OH
Peptide H-VLSLAQEQVGGSPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Myr-GSNKSKPK-NH2
Peptide H-Myr-GSNKSKPK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGAGAGAGAGAGAGA-OH
Peptide H-GAGAGAGAGAGAGAGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CCCC-OH
Peptide H-CCCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C12H22N4O5S4Peso molecolare:430.59 g/molH-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EVQLVQSGAEVK-OH
Peptide H-EVQLVQSGAEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGESAEFVCK-OH
Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPTPNVSVVDLTCR-OH
Peptide H-VPTPNVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLDSGIHFGA-OH
Peptide H-YLDSGIHFGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLNFFTK-OH
Peptide H-YLNFFTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VRIGHLYIL-OH
Peptide H-VRIGHLYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGGRLSYSRRRFSTSTGR-OH
Peptide H-RGGRLSYSRRRFSTSTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRWIQLGLQK-OH
Peptide H-RRWIQLGLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.KRAS (5-14) G12C
Kirsten rat sarcoma viral oncogene homolog (KRAS) is a proto-oncogene which encodes a GTPase linked to cell proliferations. This is part of the RAS family of GTPases (KRAS, NRAS, HRAS). Missense mutations in KRAS have prevalence in human malignancies, in particular those at the codon G12 position. Peptides of KRAS which cover G12 mutations can be employed as tumor-specific peptide neoantigens (TSAs), thus potential targets of cancer vaccines and immunotherapies. Cymit Quimica can provide the following linked peptides, and more! KRAS (5-14) WT KRAS (5-14) G12V KRAS (5-14) G12C KRASᴳ¹²ᴰ peptide You can also use our custom peptide quote tool to generate bespoke peptides with custom specs.Formula:C42H77N11O11S1Peso molecolare:944.2 g/molH-ASQSVSSYLAWYQQK-OH
Peptide H-ASQSVSSYLAWYQQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PKEK-OH
Please enquire for more information about H-PKEK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurezza:Min. 95%H-TFPDLESEF-OH
Peptide H-TFPDLESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGIDWASGR-OH
Peptide H-YGIDWASGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CWGLRKLRKRLLR-OH
Peptide H-CWGLRKLRKRLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ITKPALLVLNEHTAK-OH
Peptide H-ITKPALLVLNEHTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRGKWQRRYR-OH
Peptide H-LRGKWQRRYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QRSYVSGVL-OH
Peptide H-QRSYVSGVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLFRALLRLLRSLWRLLLRA-NH2
Peptide H-GLFRALLRLLRSLWRLLLRA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSSNYCCELCCNPACTGCY-OH
CAS:H-NSSNYCCELCCNPACTGCY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C79H112N22O30S6Peso molecolare:2,042.28 g/mol
