Peptidi
Sottocategorie di "Peptidi"
Trovati 29595 prodotti di "Peptidi"
H-NDPTQQIPK-OH
Peptide H-NDPTQQIPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AADTAPADSLYSRC-OH
Peptide H-AADTAPADSLYSRC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGLQLSQDPTGR-OH
Peptide H-TGLQLSQDPTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QEVPLATLEPLVK-OH
Peptide H-QEVPLATLEPLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDSILAVR-OH
Peptide H-EDSILAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRQPPRSISSHP-OH
Peptide H-RRQPPRSISSHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SWMESEFRVY-OH
Peptide H-SWMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYKDHDGDYKDHDIDYKDDDDK-OH
H-DYKDHDGDYKDHDIDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-CQGQPERDEKIKEPT-OH Acetate salt
Please enquire for more information about H-CQGQPERDEKIKEPT-OH Acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageH-DYKDDDDKDYKDDDDKDYKDDDDK-OH
H-DYKDDDDKDYKDDDDKDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RHHLQDHFLEIDKKNC-OH
Peptide H-RHHLQDHFLEIDKKNC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH
H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C211H318N62O59S3Peso molecolare:4,763.42 g/molH-VSEHFSLLF-OH
Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIANFKIEPPGLFRGRGNHP-OH
Peptide H-RIANFKIEPPGLFRGRGNHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NQAEEELIK-OH
Peptide H-NQAEEELIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LYATVIHDI-OH
H-LYATVIHDI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-DLISNINVIVLELK-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-EITPEKNPQ-OH
Peptide H-EITPEKNPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKKKKKK-OH
Peptide H-KKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSDQIHFFFAK-OH
Peptide H-TSDQIHFFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSTLGLDIETATR-OH
H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-INWLKLGKMVIDAL-OH
H-INWLKLGKMVIDAL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C76H129N19O17SPeso molecolare:1,613.04 g/molH-AFLLTPR-OH
Peptide H-AFLLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLVELEHTL-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-FSKKDKPLCKKHAHSVNF-OH
Peptide H-FSKKDKPLCKKHAHSVNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KTCPVQLWV-OH
Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DCAWHLGELVWCT-OH
Peptide H-DCAWHLGELVWCT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DISEMFLQIYK-OH
Peptide H-DISEMFLQIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HPNIEEVAL-OH
Peptide H-HPNIEEVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRPEYTPIHLS-OH
Peptide H-CRPEYTPIHLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YEVHHQKL-NH2
Peptide H-YEVHHQKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDSPASSKP-OH
Peptide H-RGDSPASSKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C40H68N14O16Peso molecolare:1,001.1 g/molH-VLHPLEGAVVIIFK-OH
Peptide H-VLHPLEGAVVIIFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRSFIEDLLF-OH
Peptide H-KRSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIGPGQAFYATGDII-OH
Peptide H-RIGPGQAFYATGDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YCQVVCTYHPR-OH
Peptide H-YCQVVCTYHPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDIER-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-SLLSEFCRV-OH
Peptide H-SLLSEFCRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WWKR-NH2
Peptide H-WWKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CYSLYGTTL-OH
Peptide H-CYSLYGTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPTIVMVDAYKRYK-OH
Peptide H-VPTIVMVDAYKRYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLLLDFR-OH
Peptide H-LLLLDFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQNMIR-OH
Peptide H-WYQNMIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SALVNEYNVDASR-OH
Peptide H-SALVNEYNVDASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVSPFIPLL-OH
Peptide H-IVSPFIPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MTEQQWNFAGIEAAA-OH
Peptide H-MTEQQWNFAGIEAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPQKRPSCIGC-OH
Peptide H-RPQKRPSCIGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
