Peptidi

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

Lysyllysine dihydrochloride: enzyme-cleavable linker for delivering bioactive peptides.

<p>Mots-C acetate salt form</p>

Methyltetrazine magnetic beads are uniform polymer-based magnetic spheres of 1 µm diameter. A unique surface means low nonspecific binding in protein-based systems, and superior handling without the use of surfactant. These high-binding beads are suitable for use across a range of research and diagnostic applications, whether you’re working at laboratory scale or have the more stringent requirements of high throughput applications. Activation level: 20-35 nmol methyltetrazine groups per mg Bead diameter: 0.8-1 µmThe magnetic beads are not stable in organic solvents.  Work in aq. solutions at a pH range of 4-9.

<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>

H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.

Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.

<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>

Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>

<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>

<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>

<p>BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.</p>

<p>Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.

<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>

<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>

H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.

<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>