Peptidi
Sottocategorie di "Peptidi"
Trovati 29799 prodotti di "Peptidi"
Crustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Peso molecolare:930.04 g/molRef: 3D-VAC-00190
Prodotto fuori produzioneRef: 3D-VAC-00032
Prodotto fuori produzione[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Peso molecolare:2,311.60 g/molRef: 3D-VAC-00893
Prodotto fuori produzionebeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formula:C170H253N47O52Peso molecolare:3,787.20 g/molRef: 3D-VAC-00310
Prodotto fuori produzioneKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SPeso molecolare:698.9 g/molRef: 3D-VAC-00610
Prodotto fuori produzioneRef: 3D-VAC-00673
Prodotto fuori produzioneAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formula:C86H119N23O23Peso molecolare:1,843.05 g/molRef: 3D-VAC-00471
Prodotto fuori produzioneDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Peso molecolare:1,524.72 g/molRef: 3D-VAC-00577
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molRef: 3D-VAC-00358
Prodotto fuori produzioneMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Peso molecolare:1,024.2 g/molRef: 3D-VAC-00018
Prodotto fuori produzioneParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SPeso molecolare:3,199.65 g/molRef: 3D-VAC-00276
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzionebeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SPeso molecolare:2,392.86 g/molRef: 3D-VAC-00589
Prodotto fuori produzioneRef: 3D-VAC-00430
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzioneAc-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formula:C41H59N9O10Peso molecolare:837.98 g/molRef: 3D-VAC-00033
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formula:C44H66N14O10SPeso molecolare:983.17 g/molRef: 3D-VAC-00207
Prodotto fuori produzionebeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formula:C68H113N19O19Peso molecolare:1,500.77 g/molRef: 3D-VAC-00506
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzioneNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Peso molecolare:1,564.86 g/molRef: 3D-VAC-00329
Prodotto fuori produzioneZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formula:C33H44N10O7•(HCl)xPurezza:Min. 95%Peso molecolare:692.77 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formula:C145H238N48O38S2Peso molecolare:3,325.86 g/molRef: 3D-VAC-00130
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H14N2O3Purezza:Min. 90%Colore e forma:PowderPeso molecolare:174.2 g/molRef: 3D-FA107958
Prodotto fuori produzioneTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Peso molecolare:1,171.33 g/molRef: 3D-VAC-00629
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Peso molecolare:882.04 g/molRef: 3D-VAC-00818
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Peso molecolare:560.61 g/molRef: 3D-VAC-00793
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzioneHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molRef: 3D-VAC-00698
Prodotto fuori produzionebeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molRef: 3D-VAC-00429
Prodotto fuori produzioneBTK derived peptide
Catalogue peptide; min. 95% purity
Formula:C72H115N17O18S2Peso molecolare:1,570.95 g/molRef: 3D-VAC-00536
Prodotto fuori produzioneFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Peso molecolare:850.00 g/molRef: 3D-VAC-00408
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzioneFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111724
Prodotto fuori produzione[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00911
Prodotto fuori produzioneParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Peso molecolare:4,472.26 g/molRef: 3D-VAC-00752
Prodotto fuori produzionebeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Peso molecolare:424.50 g/molRef: 3D-VAC-00901
Prodotto fuori produzioneH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
