Peptidi
Sottocategorie di "Peptidi"
Trovati 29780 prodotti di "Peptidi"
BAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molRef: 3D-VAC-00878
Prodotto fuori produzioneRef: 3D-VAC-00560
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurezza:Min. 95%Peso molecolare:1,550.78 g/molRef: 3D-VAC-00465
Prodotto fuori produzione[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formula:C67H110N20O17Peso molecolare:1,467.75 g/molRef: 3D-VAC-00495
Prodotto fuori produzioneα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formula:C93H136N22O27Peso molecolare:1,994.25 g/molRef: 3D-VAC-00647
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzione[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Peso molecolare:3,555.01 g/molRef: 3D-VAC-00488
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzioneα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Peso molecolare:882.04 g/molRef: 3D-VAC-00818
Prodotto fuori produzioneα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Peso molecolare:383.49 g/molRef: 3D-VAC-00035
Prodotto fuori produzioneRef: 3D-VAC-00724
Prodotto fuori produzioneAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molRef: 3D-VAC-00452
Prodotto fuori produzioneH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRef: 3D-FS108741
Prodotto fuori produzioneTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Peso molecolare:727.79 g/molRef: 3D-VAC-00424
Prodotto fuori produzioneRef: 3D-VAC-00524
Prodotto fuori produzionePrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formula:C118H182N32O32Peso molecolare:2,560.96 g/molRef: 3D-VAC-00393
Prodotto fuori produzioneH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purezza:Min. 95%Peso molecolare:552.6 g/molMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Peso molecolare:1,024.2 g/molRef: 3D-VAC-00018
Prodotto fuori produzioneRef: 3D-VAC-00566
Prodotto fuori produzione[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Peso molecolare:3,969.50 g/molRef: 3D-VAC-00921
Prodotto fuori produzioneBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molRef: 3D-VAC-00084
Prodotto fuori produzioneH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O6C2F3HO2Purezza:Min. 95%Peso molecolare:348.23 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Formula:C72H115N17O18S2Peso molecolare:1,570.95 g/molRef: 3D-VAC-00536
Prodotto fuori produzioneH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
