CymitQuimica logo
Peptidi

Peptidi

I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.

Sottocategorie di "Peptidi"

Trovati 29608 prodotti di "Peptidi"

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • Biotin-β Amyloid (1-42) Human


    Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.
    Purezza:Min. 95%
    Colore e forma:Powder

    Ref: 3D-CRB1000486

    100µg
    386,00€
    500µg
    470,00€
  • Eglin c (41-49)

    CAS:
    Eglin C (41-49) is a synthetic peptide that has been shown to inhibit the function of human leukocytes. It has been used in analytical high-performance liquid chromatography (HPLC) for the separation of peptides with different functional groups. The sequence of this peptide is CPGGKTYCYC, and it is synthesized by cleaving a larger protein at the point where the amino acid sequence begins with the letter "E". Eglin C (41-49) has also been shown to be potently inhibitory against porcine pancreatic elastase and human leukocyte elastase.
    Formula:C48H78N12O15
    Purezza:Min. 95%
    Colore e forma:Powder
    Peso molecolare:1,063.2 g/mol

    Ref: 3D-FE108681

    1mg
    289,00€
    2mg
    469,00€
    5mg
    785,00€
    10mg
    1.256,00€
    25mg
    2.654,00€
  • H-GVDEATIIDILTK^-OH


    Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41511

    ne
    Prezzo su richiesta
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).

    Ref: 3D-PP41946

    ne
    Prezzo su richiesta
  • CALP3 - Calcium like peptide 3

    CAS:
    Cell-permeable calmodulin (CaM) agonist that binds to the EF-hand/Ca2+-binding site and can activate phosphodiesterase in the absence of Ca2+ and inhibit Ca2+ mediated cytotoxicity and apoptosis.
    Formula:C44H68N10O9
    Peso molecolare:881.07 g/mol

    Ref: 3D-CRB1000724

    500µg
    206,00€
    1mg
    282,00€
  • H-MAERPEDLNLPNAVC-NH2


    Peptide H-MAERPEDLNLPNAVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43342

    ne
    Prezzo su richiesta
  • GRGD-[Cys(AF647)]


    GRGD-acid is a cell adhesive peptide containing the RGD motif. This enables it the ability to increase cell adhesion and rates of cell growth, differentiation and proliferation.When immobilised onto a Poly(etheretherketone) (PEEK) surface it has been shown to increase cell adhesion and proliferation in MC3T3-E1 cells. GRGD could therefore be used in dental implants.This peptide contains a C-terminal Alexa Fluor 647 florescent dye. A cysteine residue has been added to the C-terminus for conjugation of the dye via the cysteine thiol moiety. AF647 is a bright, far-red-fluorescent dye with excitation between 594 nm and 633 nm, and is pH-insensitive over a wide molar range.
    Colore e forma:Powder
    Peso molecolare:1,486.2 g/mol

    Ref: 3D-CRB1110931

    500µg
    386,00€
    1mg
    543,00€
  • MART-1 (27-35) (human)

    CAS:
    Tumour antigens recognised by cytotoxic T cells (CTLs) are a keen area of research to develop antigen-specific cancer therapies. However, hurdles are weak immunogenicity and high rates of degradation in vivo. In the search for a melanoma vaccine, the human tumour antigen Melan-A/MART-1 (27-35) has been used as a model to design peptides with improved characteristics for use in anti-tumour vaccines. The epitope can induce the production of melanoma-specific CD8+ T-cell responses. It has been included in melanoma antigen peptide vaccines, clinical trial data suggest that MART-1 (27-35) in human systems alongside other epitopes does affect the cellular and humoral responses, but much more work is required with this peptide to optimise it for clinical efficacy against melanoma.An alternate route that is possible but less studied is using MART-1 (27-35) to isolate CD8(+) T-cell clones with greater recognition for the epitope due to the contact with the T-cell receptor. This suggests melanomas could be targeted by optimising the T-cell receptor-peptide recognition of the T-cell repertoire by enhancing antigen targeting.
    Formula:C37H67N9O11
    Peso molecolare:813.98 g/mol

    Ref: 3D-CRB1000727

    500µg
    206,00€
    1mg
    282,00€
  • Ac-ELNNN-NH2


    Peptide Ac-ELNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48149

    ne
    Prezzo su richiesta
  • H-GQVLVFLGQSEGLR^-OH


    Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00206

    ne
    Prezzo su richiesta
  • CBL (598-612) Light


    CBL (598-612) Light.
    Peso molecolare:1,541.7 g/mol

    Ref: 3D-CRB1000948

    25nMol
    206,00€
  • Flagellin 22 (flg22)


    Flagellin is a structural protein which forms the major portion of bacterial flagellar filaments. The N- and C-terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the stretch of amino acids most conserved across bacterial species and is located towards the N-terminal of the flagellin protein.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.
    Colore e forma:Powder
    Peso molecolare:2,272.48 g/mol

    Ref: 3D-CRB1000331

    500µg
    206,00€
    1mg
    282,00€
    5mg
    891,00€
    10mg
    1.518,00€
  • EC dipeptide


    EC-acid has a formal charge of 0 and a range of biological and chemical uses. CE-acid is also available in our catalogue.
    Peso molecolare:250.1 g/mol

    Ref: 3D-CRB1001692

    500µg
    206,00€
    1mg
    282,00€
  • GS dipeptide


    Dipeptide consisting of one glycine and one serine residue with diverse uses. Primary metabolite and bronsted base, forms a complex with Cu(II) acting as a tridentate ligand.Primary metabolites are metabolically or physiologically essential and are directly involved in an organism's development, growth, or reproduction.
    Peso molecolare:162.1 g/mol

    Ref: 3D-CRB1001603

    500µg
    206,00€
    1mg
    282,00€
  • KDAMP


    Keratin-Derived anti-microbial Peptides (KDAMPs), are peptide fragment of the intermediate filament protein cytokeratin 6A. They were originally isolated from lysates of human corneal epithelial cells. KDAMPs exhibit coil structures with low α-helical content and are smaller and more stable than other known host-expressed anti-microbials.Multiple length KDAMPs have been studied for their anti-microbial properties, and different fragments show different anti-microbial spectrums. The 19 mer KDAMP peptide is rapidly bactericidal against multiple clinical isolates of Pseudomonas aeruginosa, and shows even greater activity against-Streptococcus pyogenes. However it is not active against Staphylococcus aureus-or-Escherichia coli.

    Peso molecolare:1,765.9 g/mol

    Ref: 3D-CRB1000493

    500µg
    206,00€
    1mg
    282,00€
  • H-ARTKQTARKSTGGKA-NH2


    Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44733

    ne
    Prezzo su richiesta
  • Bombesin


    Bombesin was originally isolated from the skin of the european fire-bellied toad (Bombina bombina) and has two known homologues Neuromedin B (NMB) and gastrin-releasing peptide (GRP).Bombesin-like peptides are involved in many physiological functions including: regulation of food intake- anxiety and fear-related behaviour, thermoregulation, stress response, learning and memory and in the stimulation of smooth muscle contraction. Bombesin is also a tumour marker for small cell carcinoma in the lung, gastric cancer, pancreatic cancer, and neuroblastoma.The receptors for these two peptides are known as bombesin receptor type 1 (BB1 also known as NMB receptor) and bombesin receptor type 2 (BB2 also known as GRP receptor). Bombesin shows high affinity to both of these receptor subtypes. These bombesin-like peptides and their receptors are widely distributed in the central nervous system (CNS) and gastrointestinal (GI) tract.This peptide contains an N-terminal pyroglutamyl to prevent the intramolecular cyclisation of the N-terminal of glutamine to N-pyroglutamate (pGlu).
    Peso molecolare:1,618.8 g/mol

    Ref: 3D-CRB1000583

    500µg
    206,00€
    1mg
    282,00€
  • H-LALDNGGLAR^-OH


    Peptide H-LALDNGGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41771

    ne
    Prezzo su richiesta
  • [5-FAM]-GLP-1 (7-36)


    The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life <-2 minutes) due to proteolytic degradation by the serine protease- dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical useThis peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag

    Peso molecolare:3,653.7 g/mol

    Ref: 3D-CRB1100877

    100µg
    386,00€
    500µg
    470,00€
    1mg
    543,00€
  • H-LADLQVPR^-OH


    Peptide H-LADLQVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48126

    ne
    Prezzo su richiesta
  • SARS-CoV-2 Nucleoprotein (353-370)


    The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (353-370) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Peso molecolare:2,111.1 g/mol

    Ref: 3D-CRB1001836

    500µg
    206,00€
    1mg
    282,00€
  • H-Gly-Tyr-Pro-Gly-Gln-Val-NH2


    H-Gly-Tyr-Pro-Gly-Gln-Val-NH2 is a peptide that belongs to the PAR4 family of protease-activated receptors. PAR4 is a G protein coupled receptor, which activates intracellular signaling pathways and has been identified as an important regulator of cardiovascular function. This peptide binds to PAR4 and stimulates the production of cAMP in human platelets. It also has an effect on the coagulation cascade by inhibiting thrombin formation, suggesting that it may be useful for treating hypertension or coagulopathies.
    PAR4 is expressed in various tissues including heart, kidney, lung, liver, pancreas and brain. The expression pattern varies with age and sex.

    Formula:C28H42N8O8
    Purezza:Min. 95%
    Peso molecolare:618.7 g/mol

    Ref: 3D-PAR-3673-PI

    1mg
    136,00€
    5mg
    370,00€
  • (D-Pro7)-Angiotensin I/II (1-7)


    The renin angiotensin system (RAS) consists of many angiotensin peptides involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and RAS is widely studied in relation to lifestyle-related diseases.Angiotensin 1-7 (Ang-(1-7)) is a component of the RAS. Ang-(1-7) is produced by angiotensin-converting enzyme 2 (ACE2), from the angiotensin II (Ang-II) peptide, as well as by prolylendopeptidase (PEP) and neutral endopeptidase (NEP) which produce Ang1 7 directly from angiotensin I (Ang-I).Ang-(1-7) broadly opposes Ang-II actions. Ang-(1-7) has vasodilatory and anti-oxidative effects, and exerts protective actions in hypertension, diabetes, and other cardiovascular disorders, Ang-(1-7) therefore represents a promising therapeutic target for cardiovascular and metabolic diseases. Ang (1-7) exerts its actions via its G-protein-coupled receptor, Mas. This novel arm of the RAS has effects that counterbalance those mediated by the classical ACE/Ang-II pathway.The C-terminal proline fro this peptide is in the D enantiomer.
    Colore e forma:Powder
    Peso molecolare:898.5 g/mol

    Ref: 3D-CRB1000981

    500µg
    206,00€
    1mg
    282,00€
  • TAT-AKAP79 (326-336) amide


    The activation of transient receptor potential cation channel subfamily V member 1 (TRPV1) is believed to play a role in hyperalgesia, asthma, and hypertension. TRPV1 is important for neuronal pain detection as well as the detection of heat, capsaicin, protons, and the neurotransmitter anandamide.- The scaffold protein AKAP79 targets kinases to phosphorylate TRPV1, however it has been shown that inflammatory intermediates prostaglandin-E2 or bradykinin can activate these kinases creating a route for inflammation to cause hyperalgesia.This product is composed of the TRPV1 interacting residues of AKAP79 reordered into a scrambled sequence and conjugated to the cell penetrating TAT domain at the N-terminus. This product was shown in vivo to have a potent analgesic affect due to interaction with TRPV1 but not affect the pain threshold. This product is a vital tool for research into suitable TRPV1 antagonists.
    Peso molecolare:2,877.6 g/mol

    Ref: 3D-CRB1001279

    500µg
    206,00€
    1mg
    282,00€
  • H-VVSVLTVTHQDWLNGK^-OH


    Peptide H-VVSVLTVTHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47763

    ne
    Prezzo su richiesta
  • [5-TAMRA] Galanin, Human


    Galanin is a neuropeptide synthesised and released by the brainstem locus coeruleus (LC). Galanin is expressed in most LC neurons in rodents and humans. Galanin has been shown to inhibit LC activity by hyperpolarising LC neurons, suppressing their spontaneous firing rate, and enhancing alpha2-adrenergic receptor-mediated negative feedback. Galanin is also a potent trophic and neuroprotective factor throughout the nervous system.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.Galanin protects against various physiological insults in vitro, including excitotoxicity and β-amyloid toxicity. Changes in galanin have been widely studied concerning Alzheimer's disease, and galaninergic neurons are spared in late-stage Alzheimer's relative to non-galaninergic neurones.Galanin is provided here with an N-terminal 5-TAMRA, a widely used red fluorescent reagent ideal for peptide labelling and detection. The excitation/emission for this reagent is 555 nm/580 nm. Cymit Quimica Laboratories Ltd is a custom peptide provider. If you desire an alternate dye, please contact us to request a custom synthesis.
    Peso molecolare:3,566.7 g/mol

    Ref: 3D-CRB1101555

    500µg
    386,00€
    1mg
    543,00€
  • CMVpp65 - 135 (PKRRRHRQDALPGPC)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,787.1 g/mol

    Ref: 3D-PP50961

    ne
    Prezzo su richiesta
  • CMX-8933


    The CMX-8933 peptide is a fragment of the goldfish brain neurotrophic factor ependymin which can increases the enzymatic activity of c-Jun N-terminal kinase (JNK), increase the phosphorylation of JNK and c-Jun proteins, and increase cellular levels of c-Jun and c-Fos mRNAs.
    Peso molecolare:1,192.6 g/mol

    Ref: 3D-CRB1001208

    500µg
    206,00€
    1mg
    282,00€
  • Motilin (human, porcine)


    Peptide derived from the gastrointestinal hormone Motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.
    Peso molecolare:2,697.4 g/mol

    Ref: 3D-CRB1000590

    500µg
    206,00€
    1mg
    282,00€
  • PFR-[AMC]


    PFR-[AMC]
    Peso molecolare:575.3 g/mol

    Ref: 3D-CRB1101042

    100µg
    206,00€
    500µg
    282,00€
  • SARS-CoV-2 Nucleoprotein 2 (261-275)


    The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (261-275) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Peso molecolare:1,654.9 g/mol

    Ref: 3D-CRB1001759

    500µg
    206,00€
    1mg
    282,00€
  • H-TPIESHQVEKR^-OH


    Peptide H-TPIESHQVEKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42603

    ne
    Prezzo su richiesta
  • Proinsulin C-peptide (human)

    CAS:

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formula:C129H211N35O48
    Peso molecolare:3,020.26 g/mol

    Ref: 3D-PP49951

    ne
    Prezzo su richiesta
  • beta-Amyloid (1-10) Biotin


    β-Amyloid 1-10 (Aβ1-10) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and α-secretase.-Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then α-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival. Biotin is C-terminally linked to the peptide via ethylenediamine-for convenient detection and purification. Alternative β-Amyloid fragments and labels are also available, please refer to our peptide catalogue for availability.

    Peso molecolare:1,463.6 g/mol

    Ref: 3D-CRB1001448

    500µg
    206,00€
    1mg
    282,00€
  • LCBiot-TESNKKFLPFQQFGRDIA-OH


    Peptide LCBiot-TESNKKFLPFQQFGRDIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48790

    ne
    Prezzo su richiesta
  • Methacrylate-RGD-OH


    Peptide Methacrylate-RGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48859

    10mg
    378,00€
    100mg
    673,00€
    1g
    1.206,00€
  • SIVmac239 - 10


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,618.9 g/mol

    Ref: 3D-PP50016

    ne
    Prezzo su richiesta
  • Shepherdin (79 - 87)


    Shepherdin is an antagonist of the interaction between the apoptosis protein, survivin, and the molecular chaperone, heat shock protein 90 (Hsp90). The sequence of shepherdin corresponds to the site where Hsp90 binds to survivin. Shepherdin therefore has high affinity for Hsp90 and thus disrupts survivin binding and acts as an inhibitor of Hsp90 ATPase function by competing with ATP.The survivin-Hsp90 complex is a regulator of cell proliferation and cell viability in cancer tissue. Shepherdin has anti-cancer properties and can significantly suppress the growth of lung cancer cell lines and acute myeloid leukaemia (AML) by inducing apoptosis.
    Colore e forma:Powder
    Peso molecolare:948.4 g/mol

    Ref: 3D-CRB1001139

    500µg
    206,00€
    1mg
    282,00€
  • H-GFEPTLEALFGK^-OH


    Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40185

    ne
    Prezzo su richiesta
  • H-IASNTQSR^-OH


    Peptide H-IASNTQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41965

    ne
    Prezzo su richiesta
  • H-CGKGLSATVTGGQK^GRGSR-OH


    Peptide H-CGKGLSATVTGGQK^GRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41797

    ne
    Prezzo su richiesta
  • LasB FRET substrate


    With the rise of multidrug-resistant bacteria like P. aeruginosa, the hunt for low toxicity inhibitors is paramount. A crucial part of their virulence/life cycle is cleavage of signal peptides. Type I signal peptides have a C-terminal hydrophilic domain containing a signal peptidase cleavage site commonly found in P. aeruginosa proteins that are cleaved by type I signal petidases (SPases). P. aeruginosa LasB, a type I signal peptide, is a crucial enzyme for bacterial invasion, it degrades elastin and thus aids tissue invasion, without cleavage by a SPase the protein is inactive. This peptide is an ideal candidate for enzymatic assay work in to SPase inhibitor investigations.Here we provide the substrate LasB sequence with the EDANS-Dabcyl donor quencher pair suitable for SPase inhibitor assays with FRET microscopy analysis. When this peptide is intact, fluorescence from the fluorophore (donor) EDAN is undetectable due to the proximity of the acceptor (quencher) Dabcyl. However, upon cleavage the fluorescence of the EDANS moiety, as measurably by excitation/emission 340/490nm, can be detected due to separation from the Dabcyl quencher.

    Peso molecolare:1,459.7 g/mol

    Ref: 3D-CRB1101629

    500µg
    386,00€
    1mg
    543,00€
  • ARF peptide


    ARF peptide, is the alternative frame (ARF) tumour suppressor protein which is expressed on the occurrence of oncogenic stimuli. It functions to prevent abnormal cell proliferation through inhibiting the p53 ubiquitin ligase protein Mdm2 from degrading p53. This results in the increased stability of the p53 tumour suppressor causing G1 cell cycle arrest. Additionally mouse ARF proteins can localise E2F1 and c-Myc transcriptions factors to the nucleolus therefore they are no longer able to activate S-phase promoting target gene. Again this results in cell cycle arrest, ultimately preventing tumour cell growth. It is evident that if the expression of the ARF peptide is inhibited tumour formation is more likely to occur.
    Colore e forma:Powder
    Peso molecolare:1,867.1 g/mol

    Ref: 3D-CRB1000940

    500µg
    206,00€
    1mg
    282,00€
  • H-SGPPGLQGR^-OH


    Peptide H-SGPPGLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42587

    ne
    Prezzo su richiesta
  • H-FAHTVVTSR^-OH


    Peptide H-FAHTVVTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40079

    ne
    Prezzo su richiesta
  • H-GADGVGK^SA-OH


    Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48947

    ne
    Prezzo su richiesta
  • HIV QK10


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formula:C51H86N14O13S
    Peso molecolare:1,135.4 g/mol

    Ref: 3D-PP50346

    ne
    Prezzo su richiesta
  • SARS-CoV-2 Spike (1192-1200)


    The SARS-CoV-2 spike protein is present on the outside of the virus particles and can bind to angiotensin-converting enzyme II (ACE2) present on the host cells. The C-terminal receptor binding domain (RBD) of the spike protein binds to the N-terminal peptidase M2 domain of ACE2. This receptor binding results in the internalisation of the virus-receptor complex and is, therefore the mechanism of entry of SARS-CoV-2 into host cells.The spike protein residues NLNESLIDL (1192-1200) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.
    Peso molecolare:1,029.5 g/mol

    Ref: 3D-CRB1001780

    500µg
    206,00€
    1mg
    282,00€
  • ANP (1-23)


    ANP (1-23) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in cardiovascular remodelling.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in pro-ANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.
    Colore e forma:Powder
    Peso molecolare:2,411.1 g/mol

    Ref: 3D-CRB1000641

    500µg
    386,00€
    1mg
    470,00€
  • pp89 phosphoprotein fragment [Mouse cytomegalovirus 1]


    Cytomegalovirus (CMV) is a prevalent human pathogen of concern in the immunocompromised such as during organ transplant or in AIDs patients- it can potentially be fatal. Due to the commonness of CMV, one strategy being developed is prevention of viral reactivation in immunosuppressed groups. Current antivirals have significant toxicity thus pushing the search for a specific CMV therapy.Murine CMV has been well established as a model for human CMV, including its susceptibility to T cell mediated clearance. The immediate-early protein 1 (IE1) was fragmented and used to find the best IE1 epitope as a vaccine. YPHFMPTNL, provided here, recognized by H-2 Ld-restricted CD8+ T cells was the best epitope of IE1 for T cell recognition. The fragment has been used to successfully generate CD8+ T cell clones specific for the IE1 epitope of murine CMV. This peptide has the potential to further the development of antiviral immunotherapy for CMV and better understand its ability to evade the host immunity.
    Peso molecolare:1,118.5 g/mol

    Ref: 3D-CRB1001233

    500µg
    206,00€
    1mg
    282,00€