
Peptidi
Sottocategorie di "Peptidi"
Trovati 29608 prodotti di "Peptidi"
H-LVEAFGGATK^-OH
Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AL^P^AP^IEK^-OH
Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PLP (178-191)
CAS:PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Formula:C70H106N18O22SPeso molecolare:1,583.8 g/molH-R^FF-OH
Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GEGQQHHLGGAKQAGDV-OH
Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-EDIIRNIARHLAQVGDSMDR-OH
Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIQLVEEELDR^-OH
Peptide H-GIQLVEEELDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Cys(Acm)-OH
CAS:Boc-Cys(Acm)-OH is a peptide that is used as a research tool in cell biology. It can be used to activate an antibody and is frequently used in studies of ion channels. Boc-Cys(Acm)-OH binds to the receptor, which leads to the activation of ligand binding, leading to pharmacological activity. The chemical formula for this compound is C24H38N6O7 with a molecular weight of 498.09 g/mol.Formula:C11H20N2O5SPurezza:Min. 95%Peso molecolare:292.35 g/molH-ARTKQTARKSTGGKAPRKQLA-NH2
Peptide H-ARTKQTARKSTGGKAPRKQLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-56/aa221 - 235
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,567.8 g/molAc-DPKSAAQNSKPRLSFSTKC-NH2
Peptide Ac-DPKSAAQNSKPRLSFSTKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,696.8 g/molH-S^LS^LSPGK^-OH
Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLDSEESYPYEAK^^-OH
Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Azide-IELLQARC-OH
Peptide Azide-IELLQARC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WEDWVGWI-NH2
Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVINEAWFPEDQR^-OH
Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-NLRKSGTLGHPGSL-OH
Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C194H297N55O56SPeso molecolare:4,327.9 g/molCMVpp65 - 16 (YTPDSTPCHRGDNQL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,703.8 g/molEnv 57-71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GELNEHLGLLGPYIR^-OH
Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WLQGSQELPR^-OH
Peptide H-WLQGSQELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QKSDDDYEDYASNKTC-NH2
Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-VAAWTLKAAA-NH2
Peptide Ac-VAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VINDFVEK^-OH
Peptide H-VINDFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-ERGVT-OH
Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIPGGIYDADLNDEWVQR^-OH
Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSSDVDQLGK^-OH
Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASNTAEVFFDGVR^-OH
Peptide H-ASNTAEVFFDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLQGLPR^-OH
Peptide H-VLQGLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-67
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,803.2 g/molH-SANILLDEAF^TAK-OH
Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C97H144N22O30Peso molecolare:2,098.43 g/molH-TKQTAR^^-OH
Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALILEPICCQERAA-OH
Peptide H-IALILEPICCQERAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C71H123N19O21S2Peso molecolare:1,642.98 g/molSNRP70
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,765.1 g/molGP120 - W61D - 120
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,784 g/molH-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C258H401N79O78Peso molecolare:5,857.5 g/molH-TANDLNLLILR^-OH
Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
