Peptidi
Sottocategorie di "Peptidi"
Trovati 29595 prodotti di "Peptidi"
H-KETAAAKFERQHMDS-OH
Peptide H-KETAAAKFERQHMDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C73H117N23O25SColore e forma:PowderPeso molecolare:1,748.91 g/molH-TVFHFRLL-NH2
Peptide H-TVFHFRLL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C32H40N6O9Peso molecolare:652.7 g/molH-EQVTNVGGAVVTGVTAVAQK^-OH
Peptide H-EQVTNVGGAVVTGVTAVAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.P2RX7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX7 antibody, catalog no. 70R-5124
Purezza:Min. 95%IL 13 Human
IL-13 is a cytokine that belongs to the IL-4 family of cytokines. IL-13 is an activator of B cells and mast cells. It binds to the IL-4 receptor and can activate lymphocytes, macrophages, eosinophils, basophils, and neutrophils. This cytokine has been shown to inhibit ion channels in airway epithelium cells and also bind to the alpha1 subunit of the N-methyl d-aspartate receptor. IL-13 is also a ligand for the IL-4 receptor, which may be important for its function as a regulator of other cytokines such as TNFα or IFNγ.Purezza:>95% By Sds-Page And Rp-Hplc.Ac-CVVRLKRVSLPKTKPAQ-NH2
Peptide Ac-CVVRLKRVSLPKTKPAQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-MSGRPRTTSFAES-NH2
Peptide Biot-MSGRPRTTSFAES-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Steroid Receptor Coactivator-1 (SRC-1) (686-700)
There are three members of the p160 family of steroid receptor coactivators, SRC-1, SRC-2, and SRC-3. These steroid receptor coactivators control the functional output of numerous genetic programs and serve as pleiotropic rheostats for diverse physiological processes. Coactivator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription.Peso molecolare:1,770 g/molH-VGEVIVTK^-OH
Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HLA-B*15:01 Human pp65 KMQVIGDQY
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IANVFTNAFR^-OH
Peptide H-IANVFTNAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CGVNNSNEDFREENLKTAN-NH2
Peptide Ac-CGVNNSNEDFREENLKTAN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PTH-rP (Human, 7-34 Amide)
CAS:PTH-rP (Human, 7-34 Amide), sourced from rat, and mouse and available as a 0.5mg vial, is an antagnoist of the A Parathyroid Hormone related Peptide (PTH-rP). PTH-rP is a peptide that belongs to the group of activators. PTH-rP has been shown to activate phospholipase C, which leads to increased intracellular calcium levels and activation of protein kinase C. PTH-rP also binds to the receptor for parathyroid hormone (PTH), and activates it by binding to its extracellular domain. This receptor is found in most cells in the body, including those in bone, kidney, gut and brain. The ligand-receptor interaction causes an increase in intracellular calcium levels that triggers a cascade of downstream effects on cell metabolism and gene expression.Formula:C153H247N49O37Purezza:Min. 95%Peso molecolare:3,364.9 g/molH-ISLPESLK^-OH
Peptide H-ISLPESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV core protein (128-140)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C66H103N17O17Peso molecolare:1,406.64 g/molH-GVFELSDEK^-OH
Peptide H-GVFELSDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 100 (DDVWTSGSDSDEELV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,653.6 g/molH-QDVDNASLAR^-OH
Peptide H-QDVDNASLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGRGKGGKGLGKGGAK-NH2
Peptide H-SGRGKGGKGLGKGGAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2
CAS:Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.
Formula:C68H89N15O25SPurezza:Min. 95%Peso molecolare:1,548.62 g/molH-LISEIDLLR^-OH
Peptide H-LISEIDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAVEDLESVGK^-OH
Peptide H-DAVEDLESVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^RPPGFSPF-OH
Peptide H-K^RPPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Diprotin A
CAS:Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.
Formula:C17H31N3O4Purezza:Min. 95%Peso molecolare:341.45 g/molCNP-22 (Human, Porcine, Rat)
CAS:CNP-22 is a peptide that has been shown to activate ion channels, inhibit protein interactions, and bind to receptors. It has been used in research as an antibody activator, ligand inhibitor, and receptor antagonist. CNP-22 is a non-protein with a molecular weight of 714.Formula:C93H157N27O28S3Purezza:Min. 95%Peso molecolare:2,197.6 g/molH-ATASRGASQAGAPQGC-NH2
Peptide H-ATASRGASQAGAPQGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSP-NH2
Peptide H-SLSLSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-PKYVKQNTLKLAT-OH
Peptide Fluor-PKYVKQNTLKLAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLYASSPGGVYATR^-OH
Peptide H-SLYASSPGGVYATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVESLFPEEAETPGSAVR^-OH
Peptide H-TVESLFPEEAETPGSAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin PLP (139-151)
CAS:Myelin PLP (139-151) is a basic protein that belongs to the family of oligodendrocyte-myelin glycoproteins. It has been shown to activate toll-like receptor, which is a pattern recognition receptor that recognizes invading pathogens and triggers an immune response. Myelin PLP (139-151) may play a role in the development of autoimmune diseases, as it has been found to be a target for autoantibodies. It has also been shown to have antioxidative properties, which may help prevent free radical damage in the brain and other tissues. The monoclonal antibody against this protein can be used for immunohistological analysis.Formula:C72H104N20O17Purezza:Min. 95%Peso molecolare:1,521.72 g/molH-KVLEHVVR^V-OH
Peptide H-KVLEHVVR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGEFSGANK^-OH
Peptide H-VGEFSGANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 75 (TSHEHFGLLCPKSIP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,665.9 g/molCMVpp65 - 74 (DVAFTSHEHFGLLCP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,672.9 g/molMotilin (human, porcine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C120H188N34O35SPeso molecolare:2,699.1 g/molH-FSISWAR^-OH
Peptide H-FSISWAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 131 (YRIFAELEGVWQPAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,750 g/molH-Thr-Phe-Leu-Leu-Arg-NH2
CAS:The endothelium is a layer of cells that lines the inner surface of blood vessels and lymphatic vessels, forming a barrier between circulating blood or lymph and the rest of the body. It is involved in maintaining vascular homeostasis as well as in inflammation. The endothelium regulates vascular tone and blood pressure through release of nitric oxide (NO) and other substances, such as prostacyclin, vasoactive peptides, endothelin-1, tumor necrosis factor-α, interleukin-1β, and thromboxane A2. Endothelial cells are activated by various means such as increased intracellular Ca2+ concentration or basic fibroblast growth factor (bFGF). This activation can be inhibited by receptor antagonists such as neurokinin-1 receptor antagonists.Formula:C31H53N9O6Purezza:Min. 95%Peso molecolare:647.81 g/molBoc-D-Thr(Bzl)-OH
CAS:Boc-D-Thr(Bzl)-OH is a peptide that is used as an activator or inhibitor of ion channels. It has been shown to inhibit the activity of L-type voltage dependent calcium channels and N-type voltage dependent sodium channels, as well as potassium channels. This peptide binds to the receptor site on the channel and blocks ion transport through the channel. Boc-D-Thr(Bzl)-OH can also be used to study protein interactions with receptors and ligands, as well as pharmacology.Formula:C16H23NO5Purezza:Min. 95%Peso molecolare:309.36 g/mol(Pro-Hyp-Gly)5 • 10 H2O
Prolyl Endopeptidase is a polypeptide that belongs to the family of enzymes known as endopeptidases. It is involved in peptide degradation and has been shown to be inhibited by synthetic products. Prolyl Endopeptidase is structurally similar to other members of the serine protease family and has been shown to hydrolyze the polypeptide bond adjacent to proline residues.Formula:C60H87N15O21•10H2OPurezza:Min. 95%Peso molecolare:1,534.55 g/molH-GILIDTSR^-OH
Peptide H-GILIDTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPLSLPVGPR^-OH
Peptide H-LPLSLPVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
