Peptidi
Sottocategorie di "Peptidi"
Trovati 29707 prodotti di "Peptidi"
Dynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111724
Prodotto fuori produzioneDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formula:C64H114N22O12Peso molecolare:1,383.76 g/molRef: 3D-VAC-00412
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzioneRef: 3D-VAC-00213
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzioneRef: 3D-VAC-00566
Prodotto fuori produzioneRef: 3D-VAC-00916
Prodotto fuori produzioneTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purezza:Min. 95%Peso molecolare:1,765.06 g/molRef: 3D-FT109022
Prodotto fuori produzioneZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C36H39F3N6O13SPurezza:Min. 95%Peso molecolare:852.79 g/molRef: 3D-FA110597
Prodotto fuori produzioneHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Peso molecolare:2,570 g/molRef: 3D-VAC-00241
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzione[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SPeso molecolare:729.86 g/molRef: 3D-VAC-00699
Prodotto fuori produzioneMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SPeso molecolare:2,625 g/molRef: 3D-VAC-00461
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purezza:Min. 95%Peso molecolare:566.48 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formula:C78H121N21O20Peso molecolare:1,673 g/molRef: 3D-VAC-00160
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzione
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
