Peptidi
Sottocategorie di "Peptidi"
Trovati 29801 prodotti di "Peptidi"
α-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Formula:C40H61N11O9Peso molecolare:840.00 g/molRef: 3D-VAC-00866
Prodotto fuori produzioneAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formula:C50H72N13O15PPeso molecolare:1,126.20 g/molRef: 3D-VAC-00342
Prodotto fuori produzioneIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Peso molecolare:5,102.84 g/molRef: 3D-VAC-00769
Prodotto fuori produzioneRef: 3D-VAC-00916
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formula:C44H67N13O9Peso molecolare:922.11 g/molRef: 3D-VAC-00244
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formula:C149H224N44O45SPeso molecolare:3,383.78 g/molRef: 3D-VAC-00093
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzioneFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Peso molecolare:850.00 g/molRef: 3D-VAC-00408
Prodotto fuori produzioneRef: 3D-VAC-00530
Prodotto fuori produzioneGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molRef: 3D-VAC-00803
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzionePannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Peso molecolare:1,441.62 g/molRef: 3D-VAC-00371
Prodotto fuori produzione[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Peso molecolare:344.41 g/molRef: 3D-VAC-00516
Prodotto fuori produzioneCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formula:C47H85N14O13SPeso molecolare:1,087.35 g/molRef: 3D-VAC-00274
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzione[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Peso molecolare:1,406.62 g/molRef: 3D-VAC-00493
Prodotto fuori produzioneRef: 3D-VAC-00664
Prodotto fuori produzione
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
