Informazioni sul prodotto
- Corticorelin
- Corticotropin-Releasing Factor, Human and Rat
- Crf (Human, Rat)
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Proprietà chimiche
Richiesta tecnica su: 01-4011473 CRF (human, rat)
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.