Nucleobindin 1 antibody
Rif. 3D-70R-1581
100µl | 697,00 € |
Informazioni sul prodotto
Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Proprietà chimiche
Richiesta tecnica su: 3D-70R-1581 Nucleobindin 1 antibody
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.