RHOT1 antibody
Rif. 3D-70R-5953
100µl | 762,00 € |
Informazioni sul prodotto
RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Proprietà chimiche
Richiesta tecnica su: 3D-70R-5953 RHOT1 antibody
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.