CymitQuimica logo

Amyloid beta-Protein (1-40) trifluoroacetate salt

CAS:

Rif. 3D-FA108378

1mg
693,00€
2mg
1.088,00€
5mg
2.286,00€
250µg
272,00€
500µg
443,00€
Amyloid beta-Protein (1-40) trifluoroacetate salt
Biosynth

Informazioni sul prodotto

Nome:Amyloid beta-Protein (1-40) trifluoroacetate salt
Sinonimi:
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Marchio:Biosynth
Descrizione:Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.

Proprietà chimiche

Peso molecolare:4,329.81 g/mol
Formula:C194H295N53O58S
Purezza:Min. 95%

Richiesta tecnica su: Amyloid beta-Protein (1-40) trifluoroacetate salt

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
◻️
CYMIT QUÍMICA, S.L., in qualità di responsabile del trattamento, tratterà i suoi dati per rispondere alle sue domande o richieste. Potete accedere, rettificare e cancellare i vostri dati, così come esercitare altri diritti consultando le informazioni supplementari e dettagliate sulla protezione dei dati nella nostra Informativa sulla privacy.
* Campi obbligatori.