AC-45181 - tiniv-oxide-99-pure | 18282-10-5

<p>PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY</p>

Allatostatiniv is an analog of β-amino acid that has inhibitory properties. It is used as a diagnostic agent for identifying the presence of neuropeptide Y (NPY) receptors in bacteria. Allatostatiniv binds to the NPY receptor and inhibits its activity, which can be determined by measuring the radioactive metabolism of [3H]-labeled allatostatiniv. The concentration of allatostatiniv required to inhibit 50% of the receptor activity is known as the IC50 value. Allatostatiniv has been shown to have high affinity for neuropeptide Y receptors in Stenotrophomonas maltophilia and low potency against other infectious diseases.