Product correctly added to cart.

discount label
CRF (human, rat)
View 3D

Bachem logo

CRF (human, rat)

CAS: 86784-80-7

Ref. 01-H-2435

282.00 €Add to cart
1,001.00 €Add to cart
Estimated delivery in United States, on Tuesday 7 Dec 2021

Product Information

CRF (human, rat)
  • Corticorelin, Corticoliberin, CRF-41, CRH, Corticotropin Releasing Factor, human, rat
  • Corticotropin-Releasing Factor, Human and Rat
  • Crf (Human, Rat)
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Long term storage:

Chemical properties

Molecular weight:
≥ 99%
White Powder
Melting point:
Boiling point:
Flash point:
InChI key:
HS code:

Hazard Info

UN Number:
H Statements:
P Statements:
Forbidden to fly:
Hazard Info:
Packing Group:

Technical inquiry about: 01-H-2435 CRF (human, rat)

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.

Please make sure to include the country code in the phone number. Check Wikipedia to find the country code.

Thank you!

Welcome to CymitQuimica!Please accept the use of cookies to have a better experience on our website.

Cookies are important for you, they influence your browsing experience, they help us to protect your privacy and allow us to proceed with the requests that you demand through this website. We use our own and third-party cookies to analyze our services and provide you with advertising related to your preferences on the basis of a profile made from your browsing habits (for example, visited pages). If you consent to its installation, click on "Accept Cookies", or you can also set your preferences by clicking "Show cookie settings". More information is available in our Cookies Policy.