Amyloid beta-Protein (1-40) trifluoroacetate salt
CAS: 131438-79-4
Ref. 3D-FA108378
1mg | 741.00 € | ||
2mg | 1,157.00 € | ||
5mg | 2,517.00 € | ||
250µg | 290.00 € | ||
500µg | 470.00 € |
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
- L-Valine,L-a-aspartyl-L-alanyl-L-a-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-a-aspartyl-L-serylglycyl-L-tyrosyl-L-a-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-a-glutamyl-L-a-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-
- Amyloidb-peptide(1-40)(human)
- H-asp-ala-glu-phe-gly-his-asp-ser-gly-phe-glu-val-arg-his-asp-ser-gly-phe-glu-val-arg-his-gln-lys-leu-val-gly-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-oh
- ss-Amyloid (1-40), rat
- Beta-Amyloid Protein(1-40)
- Beta-Amyloid 1-40,human
- Abeta 1-40
- β-Amyloid(1-40)Human
Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.
Chemical properties
Technical inquiry about: 3D-FA108378 Amyloid beta-Protein (1-40) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.