Amyloid beta-Protein (1-46)
CAS: 285554-31-6
Ref. 3D-FA109831
1mg | 911.00 € | ||
2mg | 1,500.00 € | ||
100µg | 192.00 € | ||
250µg | 359.00 € | ||
500µg | 556.00 € |
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV-OH
Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FA109831 Amyloid beta-Protein (1-46)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.