Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt
CAS: 1678415-68-3
Ref. 3D-FA110091
1mg | 865.00 € | ||
2mg | 1,414.00 € | ||
100µg | 182.00 € | ||
250µg | 343.00 € | ||
500µg | 526.00 € |
Product Information
- H-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe- Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-A sp-Leu-Gly-Ser-His-Asn-Val-Ala-OH H-AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA-OH
Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FA110091 Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.