Gastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS: 134846-93-8
Ref. 3D-FG109097
1mg | 922.00 € | ||
2mg | 1,478.00 € | ||
5mg | 3,213.00 € | ||
250µg | 359.00 € | ||
500µg | 556.00 € |
Product Information
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln- Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 H-YA EGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Please enquire for more information about Gastric Inhibitory Polypeptide (1-30) amide (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FG109097 Gastric Inhibitory Polypeptide (1-30) amide (porcine)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.