(Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
CAS: 1802080-88-1
Ref. 3D-FG109822
1mg | 376.00 € | ||
2mg | 574.00 € | ||
5mg | 1,018.00 € | ||
10mg | 1,714.00 € | ||
500µg | 236.00 € |
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys -Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH2 H-DA EFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH2
Please enquire for more information about (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FG109822 (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.