(Nle 35)-Amyloid b-Protein (1-40) ammonium salt
CAS: 1802086-31-2
Ref. 3D-FN110048
1mg | 490.00 € | ||
2mg | 820.00 € | ||
5mg | 1,500.00 € | ||
10mg | 2,678.00 € | ||
500µg | 343.00 € |
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Nle-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OH
Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-40) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FN110048 (Nle 35)-Amyloid b-Protein (1-40) ammonium salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.