CymitQuimica logo

(Tyr36)-pTH-Related Protein (1-36) amide (chicken)

CAS:

Ref. 3D-FT109512

1mg
860.00€
2mg
1,366.00€
(Tyr36)-pTH-Related Protein (1-36) amide (chicken)
Biosynth

Product Information

Name:(Tyr36)-pTH-Related Protein (1-36) amide (chicken)
Synonyms:
  • H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg -Arg-Ile-Phe-Leu-Gln-Asn-Leu-Ile-Glu-Gly-Val-Asn-T hr-Ala-Glu-Tyr-NH2 H-AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2
Brand:Biosynth
Description:Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:4,191.71 g/mol
Formula:C184H301N57O55
Purity:Min. 95%

Technical inquiry about: (Tyr36)-pTH-Related Protein (1-36) amide (chicken)

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.