Bioquímicos e reagentes

<p>The Beta-2-microglobulin monoclonal antibody is a highly specialized antibody that targets and interacts with beta-2-microglobulin, a protein found on the surface of various cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>

<p>IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.</p>

<p>delta Catenin antibody was raised in mouse using synthetic peptide J6 (corresponding to aa 292-309) coupled to KLH as the immunogen.</p>

<p>Human IgG1 antibody was raised in mouse using IgG1 Fc region as the immunogen.</p>

<p>GPR61 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SLP76 antibody</p>

<p>Sheep polyclonal Progesterone 4 antibody</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>The MAFK antibody is a highly effective substance used in Life Sciences research. It is a recombinant antigen that specifically targets the polypeptide expression of MAFK, which plays a crucial role in various cellular processes. This antibody has been extensively studied and found to inhibit the activity of arginase, an enzyme involved in the metabolism of arginine. Additionally, it has shown potential as a therapeutic agent for non-alcoholic steatohepatitis (NASH) due to its ability to modulate the function of microvessel endothelial cells.</p>

<p>Purified recombinant USP15 protein (His tag)</p>

<p>Introducing the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside: The Ultimate Antituberculosis Solution</p>

<p>Purified recombinant SGCD protein (His tag)</p>

<p>Rat monoclonal Toll-like receptor 9 antibody</p>

<p>Purified Rabbit polyclonal MRPS30 antibody</p>

<p>Purified Polyclonal GPR153 antibody</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>The MYD88 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>TMB Substrate is a highly versatile and effective monoclonal antibody used in Life Sciences research. It is commonly used for the detection of growth factors and neutralizing inhibitors, particularly in studies related to oncostatin. This substrate offers exceptional sensitivity and produces a strong signal, making it ideal for various applications such as ELISA assays.</p>

<p>The DARPP32 antibody is a powerful tool in the field of Life Sciences and medicine. It is an inhibitor that targets the bromodomain, which plays a crucial role in proteolytic processes. This antibody has been shown to effectively inhibit tumor cell growth and metastasis by blocking the activity of metalloproteinases.</p>

<p>PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI</p>

<p>Rabbit polyclonal VAMP3 antibody</p>

<p>CAV1 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) S G G K Y V D S E G H L Y T V P(17) C of human CAV1 as the immunogen.</p>

<p>Rabbit polyclonal RAB6A antibody</p>

<p>Rabbit polyclonal SHC4 antibody</p>

<p>Rabbit polyclonal CKMT antibody (FITC)</p>

<p>Purified Polyclonal Alpha adducin antibody</p>

<p>The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.</p>

<p>IL17 antibody was raised in goat using highly pure recombinant hIL-17A as the immunogen.</p>

<p>OVA conjugated Glutathione Hapten</p>

<p>CCND1 antibody was raised in rabbit using the N terminal of CCND1 as the immunogen</p>

<p>The cMet antibody is a highly effective inhibitor that targets low-density receptors in the Life Sciences field. It has been shown to significantly reduce cortisol concentration and inhibit the activity of androgen, thereby providing relief from various hormonal imbalances. This medicament is specifically designed to target antibodies, including trastuzumab and polyclonal antibodies, which are known to play a crucial role in autoimmune disorders. The cMet antibody works by blocking the activation of tyrosine kinases, which are responsible for initiating abnormal cell growth and proliferation. With its exceptional performance in laboratory assays, this antibody has proven to be a valuable tool for researchers and clinicians alike in the pursuit of understanding and combating autoimmune diseases.</p>

<p>The USP33 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that has been developed specifically for use in human hepatocytes. This antibody is used as a medicament to target specific proteins and molecules within the cells, such as collagen, lectins, cytotoxic elastase, and growth factors like TGF-beta. The USP33 antibody has been extensively tested and validated for its efficacy in detecting and quantifying these targets in various biological samples, including human serum and pancreatic elastase. Its high specificity and sensitivity make it an essential tool for researchers and scientists working in the field of molecular biology and biochemistry.</p>

<p>ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW</p>

<p>UMODL1 antibody was raised in rabbit using the middle region of UMODL1 as the immunogen</p>

<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>

<p>The HES1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the HES1 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody is commonly utilized in studies involving collagen, alpha-fetoprotein, helicobacter, androgen, annexin, and epidermal growth factor.</p>

<p>STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL1 antibody, catalog no. 70R-9002</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 70R-8696</p>

<p>TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR</p>

<p>The Calponin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is designed for use in human serum. This antibody is specifically designed to target and bind to calponin, a protein involved in various cellular processes.</p>

<p>Mouse monoclonal CD20 antibody (biotin)</p>

<p>HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr1054)</p>

<p>The Histone H1 antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes histone H1, an important protein involved in chromatin structure and gene regulation. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>06:0-06:0 NBD pc is a mouse monoclonal antibody that recognizes the extracellular domain of the human protein, calcitonin receptor-like receptor (CLR). CLR is a GPCR that is activated by calcitonin and mediates Ca2+ signaling. 06:0-06:0 NBD pc has been used to study protein interactions, ion channels, and cell biology. 06:0-06:0 NBD pc has also been used as a research tool in pharmacology and life sciences.</p>

<p>EVX2 antibody was raised in rabbit using the middle region of EVX2 as the immunogen</p>

<p>PPM1K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA</p>

<p>SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR</p>

<p>The Influenza B antibody is a hormone peptide that possesses antiviral properties. It is widely used in the field of Life Sciences to study various aspects of influenza infection. This antibody specifically targets and neutralizes the Influenza B virus, preventing its replication and spread within the body. It has been extensively studied for its ability to inhibit the activity of autoantibodies and other immune factors associated with viral infections.</p>

<p>Region of IL11 protein corresponding to amino acids MPGPPPGPPR VSPDPRAELD STVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LLSYLRHVQW LRRAGGSSLK TLEPELGTLQ ARLDRLLRRL QLLMSRLALP QPPPDPPAPP LAPPSSAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL.</p>

<p>Streptavidin protein is a glycoprotein commonly used in Life Sciences research. It has a high affinity for biotin, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, and protein purification. Streptavidin protein is often used in conjunction with biotinylated monoclonal antibodies to detect specific biomolecules in samples.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ</p>

<p>Rabbit polyclonal TCP10 antibody</p>

<p>Rhodopsin antibody is a monoclonal antibody that specifically targets and binds to rhodopsin, an important protein involved in vision. This antibody has been extensively studied and shown to have a high affinity for rhodopsin, making it an effective tool for research and diagnostics. It can be used in various applications, such as immunohistochemistry, where it helps visualize the distribution and localization of rhodopsin in tissues. Additionally, this antibody has neutralizing properties, meaning it can block the activity of rhodopsin and inhibit its function. This makes it a valuable tool for studying the role of rhodopsin in various biological processes. Whether you're conducting research in Life Sciences or working on diagnostic applications, this rhodopsin antibody is a reliable choice that delivers accurate and reproducible results.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Rabbit polyclonal SAR1B antibody</p>

<p>IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL</p>

<p>Rabbit polyclonal PLCXD1 antibody</p>

<p>SMAD4 antibody was raised in Mouse using a purified recombinant fragment of human SMAD4 expressed in E. coli as the immunogen.</p>

<p>MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR</p>

<p>The Cyclin D1 antibody is a highly specialized Polyclonal Antibody used in immunoassays within the Life Sciences field. It specifically targets endothelial growth factors, such as fibronectin and collagen, to provide accurate and reliable results. This antibody is available in both polyclonal and monoclonal forms, giving researchers the flexibility to choose the best option for their experiments.</p>

<p>The NGAL antibody is a monoclonal antibody that specifically targets and binds to activated human serum. It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The NGAL antibody has shown promising results in inhibiting the activity of sclerostin, a protein involved in bone metabolism. Additionally, it has been found to bind to nuclear antigens and collagen, making it a valuable tool for research in various areas such as immunology and oncology. The NGAL antibody also exhibits cytotoxic effects, making it suitable for antibody-drug conjugate (ADC) development. With its high specificity and versatility, the NGAL antibody is an essential component in the arsenal of researchers and scientists working towards advancements in medical science.</p>

<p>Mouse monoclonal SAFB1 antibody</p>

<p>Purified recombinant RNF34 protein (His tag)</p>

<p>JTV-519 hemifumarate is a calcium sensitizer, which is a pharmaceutical agent designed to improve cardiac contractility. It is derived from a synthetic process focusing on modulating calcium dynamics within cardiac cells. By binding to and stabilizing the ryanodine receptor (RyR2), JTV-519 hemifumarate enhances calcium release from the sarcoplasmic reticulum during the cardiac cycle. This action leads to an increase in the sensitivity of cardiac myofilaments to calcium without increasing intracellular calcium concentration, thereby improving myocardial contractility without the pro-arrhythmic effects associated with increased calcium transients.</p>

<p>TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP</p>

<p>Rabbit polyclonal S100B antibody (biotin)</p>

<p>The GATA4 antibody is a highly specialized monoclonal antibody that is used in the field of life sciences. It specifically targets the GATA4 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies against GATA4.</p>

<p>IKAP antibody was raised in rabbit using residues 148-161 IHQDDFGESKFITV of human IKAP as the immunogen.</p>

<p>The IGF2BP2 antibody is a highly reactive and neutralizing monoclonal antibody that targets the insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications.</p>

<p>The Aprotinin antibody is a highly specialized and effective tool in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in bioassays, specifically targeting the adeno-associated virus (AAV). This antibody can be used to detect and quantify AAV in various samples, including human serum. Additionally, it has shown potential for use in the detection of alpha-fetoprotein and steroids.</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>Rabbit polyclonal FOXO4 antibody (Ser262)</p>

<p>The LDHA antibody is a monoclonal antibody that is used in the field of life sciences. It specifically targets lactate dehydrogenase A (LDHA), an enzyme involved in the conversion of pyruvate to lactate during anaerobic glycolysis. By inhibiting LDHA, this antibody can help researchers study the role of lactate metabolism in various biological processes. Whether you're conducting research or developing new therapeutic strategies, the LDHA antibody is a valuable tool for understanding and manipulating lactate levels in cells and tissues. Trust in its specificity and reliability to advance your scientific endeavors.</p>

<p>Rabbit polyclonal IL4 antibody (biotin)</p>

<p>PTGER2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Phencyclidine cyclohexyl 4 Conjugate for use in immunoassays</p>

<p>The SIX6 antibody is a growth factor that belongs to the class of polyclonal antibodies. It specifically targets and binds to the SIX6 protein, which plays a crucial role in eye development. The antibody has been extensively studied for its ability to detect and measure the levels of SIX6 in various biological samples.</p>

<p>The HSP60 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the heat shock protein 60 (HSP60), which plays a crucial role in cellular stress response and protein folding. This antibody is widely used in various applications, including immunoblotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified recombinant DAP protein (His tag)</p>

<p>IL1RA antibody was raised in rabbit using highly pure recombinant human IL-1RA as the immunogen.</p>

<p>Purified synthetic Bilirubin Conjugate protein</p>

<p>The Clenbuterol antibody is a monoclonal antibody that has neutralizing properties. It specifically targets and binds to Clenbuterol, a synthetic drug commonly used as a bronchodilator and for its anabolic effects. This antibody effectively blocks the activity of Clenbuterol, preventing it from binding to its target receptors.</p>

<p>Purified Rabbit polyclonal CAPN11 antibody</p>

<p>Purified Rabbit polyclonal EIF5B antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES</p>

<p>Rat monoclonal PLET1 antibody</p>

<p>The TXK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the chemokine known as TXK, which plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in blocking the activation of TXK.</p>