Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.115 produtos)
- Por Alvo Biológico(99.074 produtos)
- Por uso/Efeitos Farmacológicos(6.785 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.693 produtos)
- Metabólitos secundários(14.219 produtos)
Foram encontrados 130577 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
ASPH antibody
<p>ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD</p>Pureza:Min. 95%OR6C68 antibody
<p>OR6C68 antibody was raised using the N terminal of OR6C68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA</p>Pureza:Min. 95%SNAPC1 antibody
<p>SNAPC1 antibody was raised in mouse using recombinant Human Small Nuclear Rna Activating Complex, Polypeptide 1, 43Kda</p>LMBR1 antibody
<p>LMBR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQDEVSAREQHFHSQVRESTICFLLFAILYVVSYFIITRYKRKSDEQE</p>Pureza:Min. 95%AZD5991
CAS:<p>AZD5991 is a gossypol derivative that has potent antitumor activity and is an inhibitor of the apoptosis pathway. AZD5991 inhibits the expression of MCL-1, which plays a key role in the regulation of mitochondrial membrane depolarization. It also inhibits cyclin D2, which is important for cell cycle progression, and pd-l1, which regulates T cell activation. These activities indicate that AZD5991 may be a potential anticancer agent for treatment of myeloid leukemia cells or T-cell lymphomas. The enantiomer form of AZD5991 has been shown to be more potent than the racemic mixture in inducing apoptosis in cancerous cells.</p>Fórmula:C35H34ClN5O3S2Pureza:Min. 95%Peso molecular:672.3 g/molHMGCS1 antibody
<p>HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA</p>CLN8 antibody
<p>CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN</p>Pureza:Min. 95%VNN3 antibody
<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>Pureza:Min. 95%POR antibody
<p>The POR antibody is a highly specialized antibody that targets the messenger RNA (mRNA) of the primary amino acid sequence of the POR protein. This antibody is designed to specifically bind to the POR protein and can be used in various research applications, such as Western blotting, immunohistochemistry, or flow cytometry.</p>ERK2 antibody
<p>The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.</p>Pureza:Min. 95%Erythropoietin protein
<p>Erythropoietin protein is a long-acting preparation of endogenous erythropoietin, a hormone that stimulates the production of red blood cells. This protein has been shown to have various effects on different cell types. It regulates the synthesis and secretion of TGF-beta in human hepatocytes, which plays a crucial role in tissue repair and fibrosis. Erythropoietin protein can also modulate chemokine expression and enhance the migration of immune cells to sites of inflammation. Additionally, it has been used as a conjugated protein with monoclonal antibodies for targeted drug delivery. Erythropoietin protein is commonly used in the field of life sciences for research purposes and as an ingredient in pharmaceutical formulations. It can be combined with other drugs such as ketorolac, gabapentin, or imatinib to enhance their therapeutic effects. The formulation may contain excipients like collagen to improve stability and bioavailability. With its diverse applications and potent biological activity</p>Pureza:>95% By Sds-PageL1CAM antibody
<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>ROM1 antibody
<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>Pureza:Min. 95%KCNJ12 antibody
<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>Pureza:Min. 95%RGS19 antibody
<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>Pureza:Min. 95%CEA antibody
<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>SEC63 antibody
<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>Pureza:Min. 95%CRYAB antibody
<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>TST antibody
<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>Synaptotagmin antibody
<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>Pureza:Min. 95%SIGLEC7 antibody
<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>Pureza:Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>Pureza:Min. 95%E2F2 antibody
<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>CD80 antibody
<p>The CD80 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets CD80, a protein involved in immune responses. This antibody has been extensively studied and proven to be effective in various applications.</p>CK17 antibody
<p>The CK17 antibody is a highly specific monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the expression and localization of this important target molecule. The CK17 antibody has been shown to bind specifically to collagen, a major component of connective tissues, and can be used to detect collagen expression in various cell types. Additionally, this antibody has been used to study the regulation of messenger RNA (mRNA) levels for hepatocyte growth factor and ferritin, which are involved in iron homeostasis. The CK17 antibody derivative also inhibits the activity of steroid hormones and growth factors, making it a valuable tool for studying their effects on cellular processes. With its high specificity and versatility, the CK17 antibody is an essential reagent for any researcher working in the field of molecular biology or immunology.</p>HSBP1 protein
<p>MAETDPKTVQ DLTSVVQTLL QQMQDKFQTM SDQIIGRIDD MSSRIDDLEK NIADLMTQAG VEELESENKI PATQKS</p>Pureza:Min. 95%Androstenedione antibody
<p>Androstenedione antibody was raised in rabbit using 4-androstene 3,17-dione-11-protein conjugate as the immunogen.</p>Pureza:Min. 95%APBB2 antibody
<p>APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS</p>Pureza:Min. 95%RELM β antibody
<p>RELM beta antibody was raised in using highly pure recombinant human RELMbeta as the immunogen.</p>Pureza:Min. 95%MYOD1 antibody
<p>MYOD1 antibody was raised in Mouse using a purified recombinant fragment of human MYOD1 expressed in E. coli as the immunogen.</p>SLC22A7 antibody
<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>Pureza:Min. 95%Glutamine Synthetase antibody
<p>The Glutamine Synthetase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in growth factor signaling, particularly in the regulation of alpha-fetoprotein and anti-VEGF pathways. This acidic antibody exhibits strong anticoagulation and antiangiogenic properties, making it an essential tool for studying endothelial growth and erythropoietin production.</p>TCP10 antibody
<p>TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH</p>Protein S Antibody Pair
<p>Protein S Antibody Pair for detection of Human Protein S in ELISA</p>Pureza:Min. 95%RBBP8 antibody
<p>The RBBP8 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ryanodine receptor, a protein involved in calcium release from intracellular stores. This antibody has been shown to neutralize the activity of the ryanodine receptor, preventing its interaction with other proteins and inhibiting its function. In addition, the RBBP8 antibody has reactive properties, allowing it to bind to specific acid residues on target proteins. This antibody has been used in studies investigating potassium channels, ischemia reperfusion injury, and neurokinin-1 receptor signaling. Its application in research has provided valuable insights into oxidative damage and ascorbic acid metabolism. The RBBP8 antibody is a powerful tool for scientists studying various biological processes and pathways.</p>DOK5 antibody
<p>DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD</p>CPEB2 antibody
<p>CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH</p>RAB5a antibody
<p>RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.</p>VEGFR3 antibody
<p>The VEGFR3 antibody is a highly effective medicament that targets the glucan synthase and growth factor. It belongs to the class of Monoclonal Antibodies, which are known for their specificity and potency. This antibody specifically binds to epidermal growth factor (EGF) receptors on the apical membrane of cells, inhibiting their activation. By blocking the activity of EGF receptors, this monoclonal antibody prevents the binding of other cell antibodies and autoantibodies, thereby reducing inflammation and promoting healing. Additionally, studies have shown that the VEGFR3 antibody has antiviral properties and can help alleviate hepatic steatosis. With its wide range of applications in various pharmaceutical preparations, this antibody is an essential tool in modern medicine.</p>Hsp40 antibody
<p>Hsp40 antibody was raised in mouse using recombinant human Hsp40(1-340aa) purified from E. coli as the immunogen.</p>Cyclophilin B antibody
<p>Cyclophilin B antibody was raised in mouse using recombinant human Cyclophilin B (26-216aa) purified from E. coli as the immunogen.</p>LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDL</p>BAK antibody
<p>The BAK antibody is a cytotoxic monoclonal antibody that targets specific proteins in the body. It has been shown to inhibit the activity of interleukin-6, fibronectin, and other growth factors. This antibody can be used in various research and diagnostic applications, including immunoassays and protein detection. It is commonly used in life sciences research, where it has been shown to have an impact on collagen synthesis, lipoprotein lipase activity, and retinoid metabolism. The BAK antibody is also used in the development of therapeutic drugs, such as adalimumab, and has been shown to promote hepatocyte growth. With its multidrug properties and wide range of applications, the BAK antibody is a valuable tool for researchers and scientists in various fields.</p>GPR124 antibody
<p>GPR124 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%PPP2R5A antibody
<p>PPP2R5A antibody was raised using the N terminal of PPP2R5A corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW</p>BRI3 antibody
<p>The BRI3 antibody is a powerful tool in the field of Life Sciences. It is a steroid derivative that belongs to the class of monoclonal antibodies. This antibody specifically targets a molecule of interest, making it an essential tool for researchers studying various biological processes. The BRI3 antibody can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>POU5F1 antibody
<p>The POU5F1 antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It specifically targets the POU5F1 protein, also known as Oct-4, which plays a crucial role in maintaining pluripotency and self-renewal of embryonic stem cells. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>Butyrophilin antibody
<p>Butyrophilin antibody was raised in mouse using Butyrophilin purified from bovine milk fat globule membrane as the immunogen.</p>LOC645015 antibody
<p>LOC645015 antibody was raised using the middle region of LOC645015 corresponding to a region with amino acids LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD</p>JAZF1 antibody
<p>JAZF1 antibody was raised in rabbit using the N terminal of JAZF1 as the immunogen</p>Pureza:Min. 95%SLC29A2 antibody
<p>SLC29A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL</p>(S)-N2-(Benzo[D]oxazol-6-yl)-N4-(1-cyclohexylethyl)-N6-ethyl-N6-(2-(ethylamino)ethyl)-1,3,5-triazine-2,4,6-triamine
CAS:<p>Please enquire for more information about (S)-N2-(Benzo[D]oxazol-6-yl)-N4-(1-cyclohexylethyl)-N6-ethyl-N6-(2-(ethylamino)ethyl)-1,3,5-triazine-2,4,6-triamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H36N8OPureza:Min. 95%Peso molecular:452.6 g/molEpCAM antibody (Prediluted for IHC)
<p>Mouse monoclonal EpCAM antibody (Prediluted for IHC)</p>Pureza:Min. 95%HECTD2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HECTD2 antibody, catalog no. 70R-2821</p>Pureza:Min. 95%MTCH2 antibody
<p>MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL</p>MITF antibody
<p>The MITF antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the nuclear antigen MITF (Microphthalmia-associated transcription factor). MITF plays a crucial role in the regulation of gene expression, particularly in melanocytes and melanoma cells. By targeting and binding to MITF, this antibody allows researchers to study various cellular processes associated with melanoma development and progression.</p>EGR1 antibody
<p>EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS</p>GRM1 antibody
<p>The GRM1 antibody is a highly specialized antibody used in Life Sciences research and assays. It is specifically designed to target and bind to the glutamate receptor, metabotropic 1 (GRM1). This antibody plays a crucial role in studying the functions of GRM1 and its involvement in various biological processes.</p>CLN5 antibody
<p>The CLN5 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences and industrial applications. It is designed to target and inhibit collagen, a key protein involved in various cellular processes. The CLN5 antibody has been extensively studied for its ability to regulate polypeptide expression and mimic the action of certain peptides. Additionally, it has been shown to interact with protein kinases and interfere with autoantibodies.</p>
