Bioquímicos e reagentes

<p>OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KEAP1 antibody, catalog no. 20R-1096</p>

<p>Inhibitor of COX-2 cyclooxygenase</p>

<p>CSNK1D antibody was raised in Rabbit using Human CSNK1D as the immunogen</p>

<p>Rabbit polyclonal KCY antibody</p>

<p>The SSX1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to specific molecules involved in cortisol concentration regulation. This monoclonal antibody is engineered to have a high affinity for its target, ensuring effective binding and inhibition of cortisol activity.</p>

<p>The STAT1 antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an autoantibody that specifically targets the nuclear receptor STAT1, which regulates the expression of genes involved in immune responses and cell growth. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results.</p>

<p>Purified recombinant RBM17 protein (His tag)</p>

<p>entB Monoclonal Antibody</p>

<p>GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK</p>

<p>Rabbit polyclonal CDK5RAP3 antibody</p>

<p>The SYK antibody is a highly effective chromatographic tool used in scientific research. It is available in both polyclonal and monoclonal forms, allowing for versatile applications. This antibody specifically targets SYK (spleen tyrosine kinase), a protein involved in various cellular processes such as hepatocyte growth and immune response regulation.</p>

<p>The STAR antibody is a monoclonal antibody that targets the epidermal growth factor (EGF) and inhibits its activity. It is commonly used in Life Sciences research to study the role of EGF in various cellular processes. This antibody specifically binds to EGF and prevents it from binding to its receptors, thereby blocking downstream signaling pathways. The STAR antibody has been shown to have cytotoxic effects on cells that overexpress EGF receptors, making it a valuable tool for studying the effects of EGF signaling in cancer cells. Additionally, this antibody has been used to investigate the role of EGF in thrombocytopenia and hyaluronic acid metabolism. Its ability to inhibit EGF-mediated nuclear translocation and TGF-β1-induced alpha-synuclein expression highlights its potential therapeutic applications in diseases related to aberrant growth factor signaling.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A15 antibody, catalog no. 70R-6563</p>

<p>AGK antibody was raised in rabbit using the N terminal of AGK as the immunogen</p>

<p>Rabbit polyclonal MAP3K1 antibody (HRP)</p>

<p>The CD11c antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD11c protein, which is found on the surface of certain immune cells, such as dendritic cells. This antibody has been extensively studied and has proven to be highly effective in various research applications.</p>

<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>

<p>The BRAF antibody is a monoclonal antibody that specifically targets the protein kinase encoded by the BRAF gene. It is widely used in research and diagnostic applications to detect the presence of BRAF mutations, which are commonly associated with various types of cancer. The antibody works by binding to the oncogene homolog protein and facilitating its detection through techniques such as immunohistochemistry and polymerase chain reaction. This highly specific antibody provides reliable results with minimal background noise, making it an essential tool for researchers in the field of life sciences. Additionally, it can be used in combination with other antibodies or inhibitors to study the signaling pathways involved in cancer development and progression. Whether you're conducting basic research or performing clinical diagnostics, this BRAF antibody is a valuable asset that will enhance your studies and provide valuable insights into oncogenic processes.</p>

<p>Rabbit polyclonal ARPC3 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TLR2 antibody, catalog no. 33R-11064</p>

<p>Purified Polyclonal ELOVL6 antibody</p>

<p>Rabbit Polyclonal LKB1 antibody (Ser334)</p>

<p>Purified recombinant CCN1 protein (His tag)</p>

<p>Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL</p>

<p>DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI</p>

<p>Pancoprida is a bioactive peptide, which is a synthetic compound derived from rational peptide design and combinatorial chemistry techniques. It functions through the modulation of specific receptor pathways, primarily targeting neuronal and inflammatory processes. Pancoprida exhibits high affinity for serotonin receptors, influencing neurotransmitter release and uptake, and also modulates certain cytokine pathways, thereby reducing inflammation.</p>

<p>PF-04701475 is a drug that inhibits the mitochondrial pathway of glutamate metabolism, which leads to the production of reactive oxygen species and neurodegeneration. PF-04701475 has been shown to be effective in treating symptoms of Alzheimer's disease in preclinical studies. It also has anti-inflammatory properties and may be useful for treating nervous system diseases, such as Parkinson's disease. PF-04701475 is currently under clinical development for the treatment of Parkinson's disease.</p>

<p>DDI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2M5 antibody, catalog no. 70R-9871</p>

<p>Recombinant Human HDGFL1 protein</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>DCUN1D5 antibody was raised in Rabbit using Human DCUN1D5 as the immunogen</p>

<p>Horse Serum Albumin is a native protein and antigen that is commonly used in the field of Life Sciences. It can be utilized for various applications such as antibody production, protein purification, and immunoassays. Horse Serum Albumin has been shown to exhibit low cytotoxicity and high stability, making it an ideal choice for research purposes. Additionally, it has been used as a blocking agent to reduce non-specific binding in assays involving monoclonal antibodies. With its diverse range of applications and reliable performance, Horse Serum Albumin is a valuable tool for scientists and researchers in the Life Sciences field.</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT</p>

<p>Rabbit polyclonal ALPL antibody</p>

<p>DOK4 antibody was raised in rabbit using the C terminal of DOK4 as the immunogen</p>

<p>TFAP2C antibody was raised in rabbit using the middle region of TFAP2C as the immunogen</p>

<p>GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE</p>

<p>Rabbit polyclonal MUC16 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPYSL2 antibody, catalog no. 70R-5234</p>

<p>Rabbit polyclonal RPL26L1 antibody</p>

<p>Pep4c is a fatty acid that is trifunctional. It has optical properties and is used for whole-cell patch-clamp studies. Pep4c has been shown to have modulating effects on excitotoxicity, which may be due to its ability to inhibit the phospholipase C/protein kinase C pathway in neurons. This compound also has functional groups, such as carboxylate, that are important for polymerization initiation. Pep4c is soluble in water and has a particle size of 20 nm and a diameter of 4 nm. Pep4c sequences are potentiated by other compounds with similar sequences.</p>

<p>The SMAD2 antibody is a highly specialized monoclonal antibody that targets SMAD2, a protein involved in the regulation of cell growth and development. This antibody is derived from human serum and has been extensively studied in the field of Life Sciences. It specifically binds to SMAD2 dimers and prevents their interaction with other binding proteins, thereby inhibiting the downstream signaling pathway of a specific growth factor. The SMAD2 antibody can be used for various applications such as immunoassays, immunohistochemistry, and Western blotting. It offers high specificity and sensitivity, making it an ideal tool for researchers in the field. Additionally, this antibody is available in both monoclonal and polyclonal forms to suit different experimental needs.</p>

<p>FMR1 antibody was raised in Rabbit using Human FMR1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Hmx3 antibody, catalog no. 70R-8774</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal PLCG2 antibody (Tyr1217)</p>

<p>RNF175 antibody was raised using the middle region of RNF175 corresponding to a region with amino acids YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII</p>

<p>The AKT1 antibody is a highly specialized antibody that targets the AKT1 protein, which plays a crucial role in various cellular processes. This antibody specifically binds to the AKT1 protein and can be used in various research applications and assays. It has been shown to be effective in detecting and quantifying the levels of AKT1 protein in samples such as human serum or tissue lysates.</p>

<p>The Myc antibody is a protein that specifically targets and binds to the Myc protein, a transcription factor that plays a critical role in cell growth and proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of the Myc protein. It can be used for various applications, including Western blotting, immunoprecipitation, immunohistochemistry, and flow cytometry.</p>

<p>Rabbit polyclonal SSR4 antibody</p>

<p>GLRA1 antibody was raised in rabbit using the middle region of GLRA1 as the immunogen</p>

<p>RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ</p>

<p>Neisseria gonorrhoeae antibody was raised in rabbit using whole Neisseria gonorrhoeae; ATCC 31426 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RMI1 antibody, catalog no. 70R-5555</p>

<p>Purified Polyclonal Kv3.1 antibody</p>

<p>TAK-071 is a small-molecule pharmaceutical compound designed to modulate neuronal signaling. It is derived from rigorous medicinal chemistry optimization processes aimed at discovering selective central nervous system agents. TAK-071 acts as a positive allosteric modulator of the muscarinic M1 receptor, which is a subtype of the acetylcholine receptor widely distributed in the brain. Its mode of action includes enhancing cholinergic neurotransmission through selective binding and modulation, thus amplifying the effects of endogenous acetylcholine without directly activating the receptor itself.</p>

<p>The Progesterone Receptor Antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the progesterone receptor, a protein involved in various cellular processes. It can be used to study the role of progesterone signaling in hormone regulation, cell growth, and development.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VSIG1 antibody, catalog no. 70R-7017</p>

<p>CD59 antibody was raised in Rabbit using Human CD59 as the immunogen</p>

<p>ACCN4 antibody was raised using the middle region of ACCN4 corresponding to a region with amino acids NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS</p>

<p>Purified Rabbit polyclonal HS1 antibody (Tyr378)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM173 antibody, catalog no. 70R-2359</p>

<p>The SNAP25 antibody is a polyclonal antibody that specifically targets the protein kinase SNAP25. It is commonly used in life sciences research to study the function and regulation of this important protein. This antibody has been extensively tested and validated for various applications, including immunofluorescence, immunohistochemistry, and western blotting.</p>

<p>SYT1 antibody was raised in Mouse using a purified recombinant fragment of SYT1 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMG1 antibody, catalog no. 70R-3339</p>

<p>Purified Polyclonal MLL4 antibody</p>

<p>The ID2 antibody is a monoclonal antibody that has cytotoxic effects and is used in the treatment of thrombocytopenia. It specifically targets and binds to ID2, a protein involved in cell growth and differentiation. By binding to ID2, this antibody inhibits its activity and prevents abnormal cell growth. The ID2 antibody has also been shown to inhibit the production of growth factors such as collagen and superoxide, which are involved in the progression of various diseases. Additionally, this monoclonal antibody can be used as a research tool in the field of life sciences to study the role of ID2 in different cellular processes. Its potential applications include studying the effects of ID2 inhibition on epidermal growth factor signaling, chemokine production, and TNF-α-mediated inflammation. With its ability to target specific proteins and regulate their functions, the ID2 antibody is a valuable tool for researchers and has promising therapeutic potential as well.</p>

<p>Rabbit polyclonal TAS2R16 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD1 antibody, catalog no. 70R-9016</p>

<p>1-394 amino acids: MSREMQDVDL AEVKPLVEKG ETITGLLQEF DVQEQDIETL HGSVHVTLCG TPKGNRPVIL TYHDIGMNHK TCYNPLFNYE DMQEITQHFA VCHVDAPGQQ DGAASFPAGY MYPSMDQLAE MLPGVLQQFG LKSIIGMGTG AGAYILTRFA LNNPEMVEGL VLINVNPCAE GWMDWAASKI SGWTQALPDM VVSHLFGKEE MQSNVEVVHT YRQHIVNDMN PGNLHLFINA YNSRRDLEIE RPMPGTHTVT LQCPALLVVG DSSPAVDAVV ECNSKLDPTK TTLLKMADCG GLPQISQPAK LAEAFKYFVQ GMGYMPSASM TRLMRSRTAS GSSVTSLDGT RSRSHTSEGT RSRSHTSEGT RSRSHTSEGA HLDITPNSGA AGNSAGPKSM EVSCLEHHHH HH</p>

<p>Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.</p>

<p>Affinity purified Rabbit polyclonal SENP2 antibody</p>

<p>Rabbit polyclonal SAPK/JNK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIP antibody, catalog no. 70R-3248</p>

<p>The CA19-9 Antibody is a highly specific monoclonal antibody that is used in Life Sciences research. This antibody targets the CA19-9 antigen, which is a carbohydrate structure found on the surface of certain cancer cells. The CA19-9 Antibody has been extensively tested and validated for its ability to detect and bind to this target molecule with high affinity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STRAP antibody, catalog no. 70R-1056</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM80A antibody, catalog no. 70R-3797</p>

<p>The BRAF antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the BRAF protein, which plays a crucial role in cell growth and division. This antibody has been extensively studied for its potential neuroprotective effects and its ability to inhibit the growth of cancer cells.</p>

<p>UCP3 antibody was raised in rabbit using an 18 amino acid peptide from rat UCP3 as the immunogen.</p>

<p>Goat antigen staining reagent for use in IHC</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>The LOX antibody is a monoclonal antibody that targets the LOX protein, which plays a crucial role in various biological processes. This antibody can be used in Life Sciences research to study the function and expression of LOX. It is designed to specifically bind to LOX and can be used in techniques such as immunohistochemistry and Western blotting.</p>

<p>RANKL antibody was raised in mouse using highly pure recombinant human sRANK ligand as the immunogen.</p>

<p>Rabbit polyclonal SULT1C2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF18 antibody, catalog no. 70R-6010</p>

<p>Rabbit polyclonal RPS25 antibody (biotin)</p>

<p>MRS 5698 is a pro-inflammatory cytokine that belongs to the adenosine family. It activates the adenosine A3 receptor and has been shown to have analgesic effects in animal models of neuropathic and traumatic brain injury. MRS 5698 has been shown to protect against cell apoptosis in vitro, which may be due to its activation of the galr1/galr2 receptor subtype.</p>

<p>ORAI1 antibody was raised using the N terminal of ORAI1 corresponding to a region with amino acids HPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVT</p>

<p>CHRFAM7A antibody was raised using the N terminal of CHRFAM7A corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC</p>

<p>The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.</p>

<p>GBP2 antibody was raised in Rabbit using Human GBP2 as the immunogen</p>

<p>RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogen</p>

<p>Conjugated Estradiol 6 CMO-Alk Phos hapten</p>

<p>Rabbit polyclonal PCDHB12 antibody</p>

<p>Purified Rabbit polyclonal USP35 antibody</p>

<p>The AP2M1 antibody is a highly specialized monoclonal antibody that targets the growth factor receptor AP2M1. It is colloidal in nature and has been specifically designed to bind to chemokines and antibodies, making it an essential tool in various life sciences research applications. The AP2M1 antibody has shown significant efficacy in studies involving breast cancer cell line MCF-7, where it demonstrated its ability to inhibit fatty acid uptake and disrupt intracellular trafficking of epidermal growth factor receptors. Additionally, this monoclonal antibody has been found to have potent anti-collagen activity and can be used for targeted therapy against diseases such as rheumatoid arthritis or fibrosis. Its activation potential on mesenchymal stem cells further highlights its versatility and potential applications in regenerative medicine.</p>

<p>MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL</p>