Bioquímicos e reagentes

<p>CD44 Monoclonal Antibody (RPE)</p>

<p>Purified recombinant SCL70 protein</p>

<p>The Caspase 3 antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to target and detect the activity of caspase enzymes, which play a crucial role in programmed cell death (apoptosis). This antibody has been extensively validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal DYNC1LI1 antibody</p>

<p>BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV</p>

<p>The alpha Synuclein antibody is a powerful tool used in life sciences research. This monoclonal antibody specifically targets and binds to alpha Synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. By targeting this protein, the antibody allows researchers to study its role in the development and progression of these diseases.</p>

<p>MAP3K2 antibody was raised using the N terminal of MAP3K2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE</p>

<p>Purified recombinant M6PR protein (His tag)</p>

<p>Rabbit polyclonal SRA1 antibody</p>

<p>Mouse monoclonal LEMD3 antibody</p>

<p>Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr125)</p>

<p>NPY1R antibody was raised in rabbit using a 15 amino acid peptide from mouse NPY1R as the immunogen.</p>

<p>Rabbit polyclonal SRPRB antibody</p>

<p>Purified Polyclonal ADRB2 antibody</p>

<p>ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.</p>

<p>Fa2h antibody was raised in rabbit using the C terminal of Fa2h as the immunogen</p>

<p>PDE1C antibody was raised using the middle region of PDE1C corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR</p>

<p>HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV</p>

<p>Mouse monoclonal ERAS antibody</p>

<p>The MAOA antibody is a polyclonal antibody used in Life Sciences research and immunoassays. It specifically targets the monoamine oxidase A enzyme, which plays a crucial role in the metabolism of neurotransmitters such as serotonin, dopamine, and norepinephrine. This antibody is reactive and neutralizing, meaning it can bind to MAOA and inhibit its activity.</p>

<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GMFB antibody was raised in Rabbit using Human GMFB as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>PSA antibody was raised in Mouse using a purified recombinant fragment of KLK3 (aa26-251) expressed in E. coli as the immunogen.</p>

<p>The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect the androgen receptor, a protein that plays a crucial role in the regulation of epidermal growth factor signaling pathways. This antibody is produced using state-of-the-art techniques, ensuring high specificity and sensitivity.</p>

<p>GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG</p>

<p>Rabbit polyclonal SLC25A34 antibody</p>

<p>The FOXO4 antibody is a highly specialized protein that plays a crucial role in various biological processes. It specifically binds to FOXO4, a transcription factor involved in regulating gene expression. This antibody has been extensively studied and proven to be effective in immunoassays, making it an essential tool for researchers in the field of life sciences.</p>

<p>Purified recombinant CEACAM7 protein (His tag)</p>

<p>SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP</p>

<p>Troponin I antibody was raised in mouse using human troponin I as the immunogen.</p>

<p>Rat monoclonal B7DC antibody (biotin)</p>

<p>GPR15 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT</p>

<p>GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL</p>

<p>LY 309887 is a synthetic analog of the natural compound LY315920. It has significant cytotoxicity in prostate cancer cells and leukemia cells. LY 309887 also inhibits cell growth in l1210 murine cells by blocking the ATP synthesis, which is required for cell division. It may also be effective against autoimmune diseases due to its ability to inhibit macrophage inflammatory activity and decrease tumor xenografts. The biochemical mechanism of action for LY 309887 is unknown at this time.</p>

<p>Purified recombinant Human TK2 protein (His tag)</p>

<p>The TLR4 antibody is a highly effective product in the field of Life Sciences. It is specifically designed to neutralize tumor necrosis factor-alpha (TNF-α) and has been extensively tested in human serum. This antibody also has the ability to inhibit the activity of transforming growth factor-beta (TGF-beta), alpha-fetoprotein, phalloidin, and creatine kinase. With its neutralizing properties, it effectively targets collagen and glycoprotein, making it an ideal choice for researchers working with actin filaments and electrodes. The TLR4 antibody is a polyclonal antibody that guarantees accurate and reliable results for your experiments.</p>

<p>H6PD antibody was raised in Rabbit using Human H6PD as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using the patch-clamp technique on human erythrocytes, confirming its high efficacy. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Disarib is a potent inhibitor of protein kinases that has demonstrated anticancer activity in preclinical studies. It is an analog of the toxin disarcidin, which is isolated from the Chinese medicinal plant Hydractinia echinata. Disarib induces apoptosis in human cancer cells by inhibiting the activity of kinases involved in cell growth and survival pathways. This compound has also shown promising results as a tumor growth inhibitor in animal models. Disarib can be detected in urine samples after administration, which makes it a viable candidate for clinical development as an anticancer drug. Its unique mechanism of action and potent inhibition of kinases make it a promising option for future cancer therapies.</p>

<p>Rabbit polyclonal UGCG antibody</p>

<p>35-107 amino acids: MGSSHHHHHH SSGLVPRGSH MAPLATELRC QCLQTLQGIH LKNIQSVKVK SPGPHCAQTE VIATLKNGQK ACLNPASPMV KKIIEKMLKN GKSN</p>

<p>Purified Rabbit polyclonal KIAA0513 antibody</p>

<p>MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY</p>

<p>The SMAD1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the activated form of SMAD1. This antibody is widely used in various fields of Life Sciences research, particularly in studies related to oncostatin, e-cadherin, anti-mesothelin, and basic protein. It has been proven to be effective in detecting and quantifying the expression levels of e-cadherin in different cell types.</p>

<p>UBQLN2 protein is a diindolylmethane-related protein that plays a crucial role in various biological processes. It has been found to interact with liver microsomes and can be modulated by compounds such as indole-3-carbinol. UBQLN2 protein has been shown to bind to cations and inhibit the activity of interleukin-6 (IL-6), making it an IL-6 antagonist. This protein can also form conjugated proteins when combined with streptavidin, allowing for biotinylation and further experimental applications in the field of Life Sciences. Additionally, UBQLN2 protein has been implicated in the regulation of erythropoietin receptor signaling, which is important for growth factor-mediated erythropoiesis. Its reactive nature makes it a valuable tool for studying cellular processes and protein-protein interactions.</p>

<p>HTRA4 antibody was raised in Rabbit using Human HTRA4 as the immunogen</p>

<p>MLN antibody was raised in Rabbit using Human MLN as the immunogen</p>

<p>The PI3 protein is a versatile molecule that plays a crucial role in various biological processes. It acts as an anti-VEGF (vascular endothelial growth factor) agent, inhibiting the growth of blood vessels and reducing angiogenesis. Additionally, the PI3 protein interacts with the growth hormone receptor and dopamine, regulating their signaling pathways.</p>

<p>LDL receptor antibody was raised in rabbit using a synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.</p>

<p>Purified recombinant CHCHD3 protein (His tag)</p>

<p>KCNQ5 antibody was raised using the middle region of KCNQ5 corresponding to a region with amino acids LGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLL</p>

<p>Bnc1 antibody was raised in rabbit using the C terminal of Bnc1 as the immunogen</p>

<p>Purified recombinant PDCD1LG2 protein (His tag)</p>

<p>ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH</p>

<p>Mouse monoclonal CEND1 antibody</p>

<p>Rabbit polyclonal SeedG19 antibody</p>

<p>The Tyrosine Hydroxylase antibody is a monoclonal antibody that plays a crucial role in the Life Sciences field. It specifically targets dopamine, an important neurotransmitter involved in various physiological processes. This antibody can be used for research purposes to study the regulation and function of tyrosine hydroxylase, the enzyme responsible for dopamine synthesis.</p>

<p>Rabbit polyclonal UQCRH antibody</p>

<p>Mouse monoclonal C1orf50 antibody</p>

<p>Recombinant Human PCOLCE protein (His tag)</p>

<p>SEMG2 antibody was raised in rabbit using the N terminal of SEMG2 as the immunogen</p>

<p>The ERK1/2 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the extracellular signal-regulated kinase 1 and 2 (ERK1/2). This antibody has been extensively validated using mass spectrometric methods and is highly specific for detecting ERK1/2 protein levels.</p>

<p>HSPB1 antibody was raised in Rabbit using Human HSPB1 as the immunogen</p>

<p>CPT1A antibody was raised using a synthetic peptide corresponding to a region with amino acids  LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN</p>

<p>Mouse monoclonal CDKN1C antibody</p>

<p>Purified recombinant NUDT4 protein (His tag)</p>

<p>The BCLXL antibody is a neutralizing agent commonly used in Life Sciences research. This antibody specifically targets the BCLXL protein, which is involved in regulating cell survival and apoptosis. By binding to BCLXL, this antibody can inhibit its activity and potentially induce cell death in certain conditions.</p>

<p>Mouse monoclonal AURKC antibody</p>

<p>BCOR antibody was raised in Rabbit using Human BCOR as the immunogen</p>

<p>Rabbit polyclonal WRKY63.1 antibody</p>

<p>Syrian Hamster monoclonal NK cell antibody (FITC)</p>

<p>The RPS6 antibody is a polyclonal antibody commonly used in Life Sciences research. It specifically binds to RPS6, a protein involved in cellular processes such as protein synthesis and cell growth. This antibody is widely used as a tool to study RPS6 and its interactions with other binding proteins, inhibitors, and growth factors. Additionally, the RPS6 antibody has been shown to have neutralizing properties against certain growth factors, such as endothelial growth factor and hepatocyte growth factor. It has also been utilized in studies involving human serum proteins like fibronectin and alpha-fetoprotein. With its high specificity and versatility, the RPS6 antibody is an essential tool for researchers in various fields of study.</p>

<p>BLVRB antibody was raised in Rabbit using Human BLVRB as the immunogen</p>

<p>Rabbit polyclonal Vimmentin antibody (Prediluted for IHC)</p>

<p>Purified recombinant FBP2 protein</p>

<p>1-76 amino acids: MGSSHHHHHH SSGLVPRGSH MEEASEGGGN DRVRNLQSEV EGVKNIMTQN VERILARGEN LEHLRNKTED LEATSEHFKT TSQKVARKFW WKNVKM</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>LEP antibody was raised in Rabbit using Human LEP as the immunogen</p>

<p>The IKB alpha antibody is a growth factor monoclonal antibody that specifically targets and binds to the IKB alpha protein. This protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in various cellular processes such as inflammation, immune response, and cell survival. By binding to IKB alpha, this antibody prevents its degradation and inhibits the activation of NF-kappaB.</p>

<p>SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL</p>

<p>Rat monoclonal CD45R antibody (biotin)</p>

<p>Alpha-1 antichymotrypsin antibody was raised in mouse using affinity purified alpha-1 antichymotrypsin as the immunogen.</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>DENND1B antibody was raised using the N terminal of DENND1B corresponding to a region with amino acids YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC</p>

<p>The ATF2 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It is specifically designed to target and bind to ATF2, a protein that plays a crucial role in various cellular processes. This antibody is commonly used in research studies to investigate the function and regulation of ATF2.</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MESDC2 antibody was raised in Rabbit using Human MESDC2 as the immunogen</p>

<p>The BCR antibody is a polyclonal antibody that targets the B-cell receptor (BCR), a protein involved in the regulation of immune responses. It specifically recognizes and binds to the epitopes present on the BCR, allowing for the detection and analysis of B-cell activity. This antibody has been widely used in various life sciences research applications, including immunohistochemistry, flow cytometry, and western blotting. Additionally, it has shown potential therapeutic applications in the treatment of autoimmune diseases and certain types of cancer. With its high specificity and sensitivity, the BCR antibody is an essential tool for researchers studying B-cell biology and related fields.</p>

<p>GNE 2861 is a small molecule that inhibits the protein kinase domain of the regulatory subunit of protein kinase A (PKA-R). This compound has been shown to inhibit cell proliferation and induce apoptosis in cancer cells. GNE 2861 also induces target gene expression, which may be due to its ability to activate transcription factors. GNE 2861 is an inhibitor of PKA-R and may be suitable for use as a pharmacological treatment for cancer.</p>

<p>Purified recombinant NCK2 protein (His tag)</p>

<p>Rabbit polyclonal TLP3 antibody</p>

<p>CYP1B1 antibody was raised using the middle region of CYP1B1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY</p>

<p>The GFP Antibody is a polyclonal antibody that specifically targets the Green Fluorescent Protein (GFP). It has been extensively used in various research fields, including molecular biology, genetics, and cell biology. The GFP Antibody is highly specific and sensitive, allowing for accurate detection and quantification of GFP in different experimental systems.</p>

<p>POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL</p>

<p>The BIP antibody is a monoclonal antibody that specifically targets and neutralizes the activity of BIP (Binding Immunoglobulin Protein). This protein plays a crucial role in various cellular processes, including protein folding and quality control. The BIP antibody is derived from globulin and is produced using advanced biotechnological methods.</p>

<p>RSV antibody (FITC) was raised in mouse using nucleoprotein of RSV as the immunogen.</p>