Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of G6pc antibody, catalog no. 70R-8595</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>Recombinant human RGS17 protein</p>

<p>RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG</p>

<p>3-(1,3-Benzothiazol-2-yl)-8-((bis(2-hydroxyethyl)amino)methyl)-7-hydroxy-2H-chromen-2-one is a small molecule that has been shown to inhibit protein interactions by binding to the active site of the enzyme. It is also an activator of GPCRs and other proteins, as well as a receptor for peptides. 3-(1,3-Benzothiazol-2-yl)-8-((bis(2-hydroxyethyl)amino)methyl)-7-hydroxy-2H-- chromen 2one has been used in research to generate antibodies against various proteins and is a high purity material suitable for use in life science experiments.</p>

<p>Milk Fat Globulin Protein E8 Monoclonal Antibody</p>

<p>The INPP5B antibody is a highly effective substance used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is widely used as a test substance in various research applications. This antibody specifically targets INPP5B, an enzyme involved in the metabolism of inositol phosphates. By inhibiting the activity of INPP5B, this antibody can modulate cellular signaling pathways and provide valuable insights into various cellular processes.</p>

<p>Bromoacetamido-dPEG®12-Tris(-dPEG®11-Bromoacetamide)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®12-Tris(-dPEG®11-Bromoacetamide)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRP1 antibody, catalog no. 70R-2480</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CXorf20 antibody, catalog no. 70R-4186</p>

<p>Rabbit polyclonal RPL11 antibody (FITC)</p>

<p>Rabbit polyclonal SMAD2 antibody (Ser467)</p>

<p>The TRAF6 antibody is a highly specialized protein that specifically targets TNF-α, a key cytokine involved in inflammation and immune response. By binding to TNF-α, the TRAF6 antibody inhibits its activity and reduces the inflammatory response in the body. This has been shown to have beneficial effects on various conditions related to excessive inflammation, such as autoimmune diseases and chronic inflammatory disorders.</p>

<p>Rabbit Polyclonal alpha Synuclein antibody (Tyr125)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-2252</p>

<p>The Tau antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to the tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>FOXM1 antibody was raised in rabbit using the middle region of FOXM1 as the immunogen</p>

<p>CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV</p>

<p>Mouse monoclonal Cytokeratin 6 antibody</p>

<p>The CYP2E1 antibody is a monoclonal antibody used in life sciences research. It specifically targets the CYP2E1 enzyme, which is primarily found in the liver microsomes. This antibody has been widely used to study the role of CYP2E1 in various physiological processes, including drug metabolism, alcohol metabolism, and oxidative stress. It can be used for immunohistochemistry, western blotting, and other molecular biology techniques to detect and quantify the expression levels of CYP2E1 in different tissues and cell types. The CYP2E1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the function and regulation of this important enzyme.</p>

<p>HMG-CoA reductase inhibitor</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYZ antibody, catalog no. 70R-10029</p>

<p>SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE</p>

<p>SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL</p>

<p>The GLUT5 antibody is a highly effective and versatile tool used in various scientific and medical research applications. This monoclonal antibody specifically targets the GLUT5 protein, which plays a crucial role in the transportation of fructose across cell membranes.</p>

<p>The SERCA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the nuclear protein SERCA2, which is involved in the regulation of calcium ion transport. This antibody is commonly used to study the role of SERCA2 in various biological processes such as glucose-6-phosphate metabolism and tyrosine phosphorylation. Additionally, it has been utilized in the detection and quantification of autoantibodies, including antiphospholipid antibodies, which are associated with autoimmune disorders. The SERCA2 antibody can also be used as an anti-connexin agent to block gap junction communication and investigate its impact on cellular signaling pathways. Furthermore, this antibody has potential applications as an anticoagulant due to its ability to inhibit collagen-induced platelet aggregation. With its high specificity and versatility, the SERCA2 antibody is a valuable tool for researchers in multiple fields of study.</p>

<p>ARHGAP4 antibody was raised in Rabbit using Human ARHGAP4 as the immunogen</p>

<p>Ctsd antibody was raised in rabbit using the C terminal of Ctsd as the immunogen</p>

<p>EDC4 antibody was raised in Rabbit using Human EDC4 as the immunogen</p>

<p>17a-Testosterone 3 Conjugate for use in immunoassays</p>

<p>SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL</p>

<p>Mouse Serum Albumin protein is a highly versatile and widely used protein in the field of Life Sciences. It serves as an essential component for various research applications. This native protein is commonly used as a control or standard in experiments involving monoclonal antibody development, anti-DNP antibodies, and the study of actin filaments.</p>

<p>The AKR1B1 antibody is a glycoprotein that targets a specific human protein. It is widely used in the field of Life Sciences for its antiviral properties. This antibody is commonly used in immunoassays, where it plays a crucial role in detecting and quantifying the presence of the target protein. The AKR1B1 antibody can also be used as a tool in various research applications, such as studying fatty acid metabolism or investigating the role of progesterone in cellular processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. The AKR1B1 antibody has been extensively tested and validated, ensuring reliable and accurate results in experiments. Whether you are conducting basic research or developing diagnostic assays, this antibody is an essential tool for your scientific endeavors.</p>

<p>The Focal Adhesion Kinase antibody is a highly effective monoclonal antibody that targets and inhibits the activity of focal adhesion kinase (FAK). FAK is an important protein involved in cell signaling, cell adhesion, and cell migration. This antibody is specifically designed to bind to FAK and prevent its activation, thereby inhibiting the downstream signaling pathways that contribute to cancer progression.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM113A antibody, catalog no. 70R-4107</p>

<p>RPS6 antibody was raised in rabbit using the C terminal of RPS6 as the immunogen</p>

<p>Rabbit polyclonal HOXA7 antibody</p>

<p>Rabbit anti-goat IgG (H+L) (biotin) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>GPSN2 antibody was raised using the C terminal of GPSN2 corresponding to a region with amino acids LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymocytes as the immunogen.</p>

<p>Mouse monoclonal DTYMK antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a vital role in cellular processes such as growth, survival, metabolism, and proliferation. As a central player in the PI3K/Akt/mTOR pathway, it integrates signals essential for cellular adaptation and function. Humans have three main Akt isoforms—Akt1, Akt2, and Akt3—each encoded by separate genes. Akt activation begins when external signals, such as growth factors or insulin, bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of PIP3 on the cell membrane, recruiting Akt and initiating two crucial phosphorylation steps at Thr308 and Ser473, after which Akt becomes fully activated and moves within the cell to phosphorylate its target proteins.Akt’s core functions include promoting cell survival by inhibiting apoptosis through phosphorylation of pro-apoptotic proteins like BAD and Caspase-9, and supporting cell growth and proliferation by activating mTOR, a key regulator of protein synthesis. It also plays a significant role in metabolic regulation, increasing glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, particularly in muscle and fat tissues. Additionally, Akt promotes angiogenesis by enhancing VEGF expression, which aids tissue repair, and supports cell migration, aiding wound healing but also facilitating cancer cell spread. Due to its extensive role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor progression, making it a target for cancer therapies. Its influence on glucose metabolism also connects Akt to insulin signaling, where pathway defects can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A2 antibody, catalog no. 70R-7340</p>

<p>Purified recombinant Human XPA protein (His tag)</p>

<p>Mouse monoclonal CD205 antibody (biotin)</p>

<p>Rabbit polyclonal CBL antibody (Tyr774)</p>

<p>Rabbit polyclonal SDHA antibody (FITC)</p>

<p>The MIOX antibody is a diagnostic biomarker that plays a crucial role in the field of medicine. It is a Monoclonal Antibody that specifically targets proline-rich proteins. This antibody has been extensively studied and proven to be an effective tool in various therapeutic applications, including as inhibitors and theranostics.</p>

<p>GPRC5B antibody was raised in rabbit using the N terminal of GPRC5B as the immunogen</p>

<p>Rabbit polyclonal ADCK4 antibody</p>