Bioquímicos e reagentes

<p>IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ</p>

<p>MB antibody is a polyclonal antibody that specifically targets the isoenzyme of creatine kinase known as MB. This antibody is widely used in the field of Life Sciences to study various aspects of cardiovascular health and disease. The MB antibody has been shown to be effective in neutralizing the activity of collagen, a protein involved in tissue repair and remodeling. Additionally, this antibody can also be used as a diagnostic tool for detecting the presence of autoantibodies associated with certain cardiovascular conditions. The MB antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific experimental needs.</p>

<p>Purified Recombinant TNFRSF18 protein (His tagged)</p>

<p>SLC4A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR</p>

<p>IBT6A is an analog of ibuprofen, a nonsteroidal anti-inflammatory drug. It has been shown to be resistant to the inactivation that normally occurs when the prostaglandin H synthase (cyclooxygenase) enzyme converts arachidonic acid into prostaglandin H2. IBT6A is also reactive with tyrosine kinases and may have therapeutic potential as a diagnostic tool for cancer.</p>

<p>FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT</p>

<p>The MARCKS antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein MARCKS (Myristoylated Alanine-Rich C Kinase Substrate), which plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The antibody recognizes specific epitopes on the MARCKS protein, including egf-like domains and sugar moieties.</p>

<p>Diethylstilbestrol p-OH Conjugate for use in immunoassays</p>

<p>The AKT1 antibody is a powerful tool in the field of Life Sciences. It is an acidic polymerase that exhibits endonuclease activity and plays a crucial role in regulating protein synthesis. This Monoclonal Antibody specifically targets the growth factor p38 mitogen-activated protein, as well as β-catenin. The activated form of this monoclonal antibody has been shown to have cytotoxic effects on various cell types, including those expressing nuclear factor kappa-light-chain-enhancer. With its high specificity and potency, the AKT1 antibody is an invaluable asset for researchers studying cellular signaling pathways and protein interactions.</p>

<p>The GATA6 antibody is a highly specific monoclonal antibody that targets the human serum. It has been extensively used in Life Sciences research to study the role of GATA6, an important transcription factor involved in various cellular processes. This antibody binds to GATA6 with high affinity and specificity, allowing for accurate detection and quantification of GATA6 levels in biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFYVE27 antibody, catalog no. 70R-1730</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Purified Polyclonal HOXA11/D11 antibody</p>

<p>Mouse monoclonal EIF2S1 antibody</p>

<p>The UBC9 antibody is a highly reactive protein that is used in various research applications. It specifically targets CD33, a cell surface marker that is expressed on certain immune cells. The UBC9 antibody can be used to detect and quantify CD33 levels in different samples, such as blood or tissue. This antibody is commonly used in life sciences research, particularly in studies related to calmodulin, adipose biology, 3-kinase signaling pathways, and activated immune cells. Additionally, the UBC9 antibody has been shown to have potential therapeutic applications in diseases caused by pathogens like Brucella abortus and oxidative stress-related conditions due to its ability to neutralize superoxide and modulate interleukin-6 activity. Trustworthy and reliable, the UBC9 antibody is an essential tool for researchers looking to explore various aspects of cellular biology and immunology.</p>

<p>NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG</p>

<p>CENPE Monoclonal Antibody BSA/Azide Free</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>The MMP19 antibody is a powerful tool used in the field of Life Sciences. It specifically targets Matrix Metalloproteinase 19 (MMP19), an enzyme that plays a crucial role in various physiological processes. This antibody is widely used in research and diagnostic applications.</p>

<p>SLC4A5 antibody was raised in rabbit using the N terminal of SLC4A5 as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody (HRP)</p>

<p>Rabbit polyclonal RFC4 antibody</p>

<p>Purified Polyclonal GABRB1 antibody</p>

<p>SMN1 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and detect Survival Motor Neuron 1 (SMN1) protein. This antibody has been extensively validated in various assays, including immunohistochemistry, Western blotting, and ELISA. SMN1 antibody can be used to study the expression and localization of SMN1 in different tissues and cell types. It has high specificity and sensitivity, ensuring accurate and reliable results. Additionally, this antibody has been shown to have minimal cross-reactivity with other proteins or molecules commonly found in human serum or biological samples. Its exceptional performance makes it an essential tool for researchers studying SMN1-related diseases or exploring the role of SMN1 in cellular processes.</p>

<p>Mouse monoclonal MMAA antibody</p>

<p>PPM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN</p>

<p>Osteonectin protein is a crucial component in the field of Life Sciences. It is commonly used in reaction solutions and can be detected using monoclonal antibodies. This Native Protein &amp; Antigen plays a significant role in various biological processes, including cellular protein synthesis and mineralization. Osteonectin protein has been found to interact with histidine, epidermal growth factor, inhibitors, liver microsomes, and human serum. Additionally, it has been studied for its potential involvement in autoimmune diseases as autoantibodies against osteonectin have been detected. Its multifunctional nature makes it a valuable tool for research and the development of new medicines.</p>

<p>The CREB antibody is a highly specialized diagnostic reagent used in Life Sciences research. It is a monoclonal antibody that specifically targets and detects the activated form of CREB (cAMP response element-binding protein), a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting activated CREB in different cell types, including human hepatocytes, pluripotent stem cells, granulosa cells, and collagen-producing cells.</p>

<p>Rabbit polyclonal TCIRG1 antibody</p>

<p>Purified Polyclonal CDC8 antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>RASGEF1A antibody was raised using the N terminal of RASGEF1A corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV</p>

<p>Tachykinin receptor NK2 antagonist</p>

<p>TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids MDRDLLRQSLNCHGSSLLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHP</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP</p>

<p>Bcl-G antibody was raised in rabbit using residues 298-312 [TKYLKENFSPWIQQH] of the human BCL-G Long form protein as the immunogen.</p>

<p>TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI</p>

<p>Slc22a3 antibody was raised in rabbit using the middle region of Slc22a3 as the immunogen</p>

<p>Park2 antibody was raised in rabbit using the C terminal of Park2 as the immunogen</p>

<p>GLYAT antibody was raised in Rabbit using Human GLYAT as the immunogen</p>

<p>The ERBB3 protein is a glycan that plays a crucial role in various biological processes. It is activated by molecules such as TNF-α and GM-CSF, which are involved in immune responses and cell growth regulation. In the field of Life Sciences, the ERBB3 protein is widely studied due to its importance in signaling pathways and cellular functions.</p>

<p>RELM beta antibody was raised in rabbit using highly pure recombinant murine RELMbeta as the immunogen.</p>

<p>ALDH3A1 antibody was raised in rabbit using the N terminal of ALDH3A1 as the immunogen</p>

<p>The E2F1 antibody is a highly specific monoclonal antibody that targets the E2F1 protein. This protein plays a crucial role in regulating cell growth and division, making it an important target for research in the field of Life Sciences.</p>

<p>The CD144 antibody is a neutralizing monoclonal antibody that specifically targets the CD144 antigen. It is commonly used in Life Sciences research to study various cellular processes and signaling pathways. The CD144 antibody can effectively block the activity of CD144, which is a low-density lipoprotein receptor-related protein involved in cell adhesion and growth factor signaling. This antibody has been shown to inhibit the binding of growth factors such as epidermal growth factor (EGF) and interferon-gamma (IFN-gamma) to their respective receptors, thereby modulating cellular responses. The CD144 antibody is highly specific and does not cross-react with other antibodies or antigens. It can be used in various experimental techniques, including immunofluorescence, immunohistochemistry, and Western blotting, to investigate the role of CD144 in different biological systems. With its high affinity and excellent performance, the CD144 antibody is an essential tool for researchers studying cell biology and molecular mechanisms.</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>