Bioquímicos e reagentes

<p>Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serum</p>

<p>H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.</p>

<p>Cyclo[Arg-Ala-Asp-D-Tyr-Lys(PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>H-VNNVPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VNNVPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VNNVPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VNNVPR-OH at the technical inquiry form on this page</p>

<p>Ibrutinib is a small-molecule inhibitor of Bruton’s tyrosine kinase, a crucial enzyme to the B-cell receptor pathway. Bruton’s tyrosine kinase becomes continuously activated in B-cell cancers and therefore promotes the survival of tumor cells. Ibrutinib binds irreversibly and covalently to a cysteine residue within the ATP-binding site of the enzyme, thus preventing ATP binding and downstream signal transduction. The ability of Ibrutinib to inhibit Bruton’s tyrosin kinase and hence the B-cell receptor pathway it can be used in the treatment of some B cell cancers such as diffuse large B-cell lymphoma (DLBCL) and chronic lymphocytic leukemia (CLL).</p>

<p>H-KQAEEMK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KQAEEMK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KQAEEMK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KQAEEMK-OH at the technical inquiry form on this page</p>

<p>H-IGLAPTKAKRRVVQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IGLAPTKAKRRVVQR-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IGLAPTKAKRRVVQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IGLAPTKAKRRVVQR-OH at the technical inquiry form on this page</p>

<p>Mobocertinib is a small-molecule tyrosine kinase inhibitor, which is a targeted therapy derived from synthetic chemistry. It primarily exerts its effect by selectively inhibiting the activity of epidermal growth factor receptor (EGFR) with exon 20 insertion mutations. These mutations, which occur in the kinase domain of the EGFR, lead to aberrant activation of signaling pathways that promote oncogenic processes.</p>

<p>Salbutamol antibody was raised in mice using Salbutamol as the immunogen.</p>

<p>Ac-CLEDMPVDPDNEA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLEDMPVDPDNEA-NH2 is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLEDMPVDPDNEA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLEDMPVDPDNEA-NH2 at the technical inquiry form on this page</p>

<p>Lenalidomide is a thalidomide derivative that is used to treat multiple myeloma and anemia. This drug exerts immunomodulatory effects by altering cytokine production. Lenalidomide also directly inhibits the cullin ring E3 ubiquitin ligase complex.</p>

<p>Elesclomol is an investigational anticancer agent, which is a small-molecule compound. It functions by targeting the cellular oxidative stress pathway; specifically, it enhances the production of reactive oxygen species (ROS) within cancer cells. By elevating ROS levels beyond the threshold tolerable by cancer cells, Elesclomol induces apoptosis through the disruption of mitochondrial function, making it selective for environments with heightened oxidative stress.</p>

<p>GENZ 882706 is a racemic mixture of two enantiomers that binds to the GABA receptor and activates it. It has been shown to be an effective inhibitor of GABA-gated currents in cultured hippocampal neurons, and has been used as a research tool for studying the role of GABA receptors in many different biological processes. This compound is also used for studying protein interactions with the GABA receptor.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal Heat Labile Enterotoxin antibody</p>

<p>Butyryl cholinesterase antibody was raised in rabbit using cholinesterase isolated from human serum as the immunogen.</p>

<p>Retinoic acid receptor alpha agonist; antineoplastic</p>

<p>Purified recombinant p47 Treponema Pallidum protein</p>

<p>Morphine antibody was raised in rabbit using morphine-hemisuccinate as the immunogen.</p>

<p>H-GASETIANIYTT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GASETIANIYTT-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GASETIANIYTT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GASETIANIYTT-OH at the technical inquiry form on this page</p>

<p>H-EFFTKNSAFPKTTNG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EFFTKNSAFPKTTNG-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EFFTKNSAFPKTTNG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EFFTKNSAFPKTTNG-OH at the technical inquiry form on this page</p>

<p>Ac-CDDGSYSVTAILFRGE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDDGSYSVTAILFRGE-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDDGSYSVTAILFRGE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDDGSYSVTAILFRGE-NH2 at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-VKMDAEC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VKMDAEC-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VKMDAEC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VKMDAEC-OH at the technical inquiry form on this page</p>

<p>H-DDAATRRRRGRRKHVEGGMD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DDAATRRRRGRRKHVEGGMD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DDAATRRRRGRRKHVEGGMD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DDAATRRRRGRRKHVEGGMD-OH at the technical inquiry form on this page</p>

<p>H-LPPALFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPPALFT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPPALFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPPALFT-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about EBV VCA IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Partial agonist of cortical and hippocampal muscarinic (M1) receptors</p>

<p>Ziprasidone is an atypical antipsychotic drug that is used to manage schizophrenia, bipolar mania, and agitation. This drug binds to serotonin and dopamine receptors. As a result it enhances modulation of mood and improves overall cognition.</p>

<p>Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about SSA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Jo-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.</p>

<p>Tazarotene is an acetylenic retinoid that is used for the treatment of wrinkles, pigmentation of the skin and acne. Although, the mechanism of action for this drug is not yet fully understood, it is thought to bind to all three members of the retinoic acid receptor family. Studies have shown that this drug is associated with increased collagen production.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Please enquire for more information about Normal Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mycoplasma pneumoniae IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PPARα transcription factor agonist</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>(-)-Carbovir is a synthetic nucleoside reverse transcriptase inhibitor (NRTI), which is derived from the enantiomerically pure isomer of carbocyclic 2'-deoxyguanosine. As an antiviral agent, its mode of action involves the inhibition of the reverse transcriptase enzyme, crucial for the replication of retroviruses, including HIV. By competing with natural nucleosides, (-)-Carbovir gets incorporated into viral DNA, causing chain termination and preventing further replication of the virus.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT</p>

<p>Irinotecan hydrochloride trihydrate is a topoisomerase I inhibitor that is used as chemotherapy drug for colorectal cancer. By inhibiting topoisomerase I, Irinotecan hydrochloride trihydrate prevents the replication of DNA in cells, and stops the cancer cells from growing and dividing. When used for chemotherapy, Irinotecan hydrochloride trihydrate is usually part of combination therapy with other chemotherapy drugs, such as 5-fluorouracil (5-FU) and leucovorin for other cancers.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>O6-Benzylguanine is a guanine analog that is an antineoplastic agent. It works by acting as a suicide inhibitor of the enzyme O6-alkylguanine-DNA alkyltransferase. This results to an interruption of DNA repair so that damage can occur to local tumor targets.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Alkaline Phosphatase (ALP, Orthophosphoric-Monoester Phosphohydrolase, systematic name phosphate-monoester phosphohydrolase (alkaline optimum), EC 3.1.3.1, CAS Number [9001-78-9]) is an enzyme that catalyzes the following reaction:  a phosphate monoester + H2O → an alcohol + phosphate  One unit catalyzes of the Alkaline Phosphatase will hydrolyze 1.0 μmol of p-nitrophenyl phosphate per minute at pH 10.4 and 37°C in glycine buffer. Human placental alkaline phosphatase comes in lyophilized form, lyophilized from tris chloride, with magnesium chloride and zinc chloride, pH 7.4. Activity is ≥10U/mg, specific activity ≥25 U/mg protein. It is soluble in Tris buffered saline containing 10 mg/mL BSA, 1 mM magnesium chloride, and 0.2 mM zinc chloride, pH 8.0. at 10 mg/mL.</p>

<p>Morphine-BSA is a product commonly used in the Life Sciences field. It is a conjugate of morphine and bovine serum albumin (BSA). This product has various applications, including research on androgen receptors, annexin neutralizing antibodies, teriparatide growth factor, osteopontin binding proteins, hybridization with anti-beta amyloid monoclonal antibodies, and more.</p>

<p>Please enquire for more information about HTLV I/II Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>